TB Genome Annotation Portal

Rv1326c (glgB)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: 14-alpha-glucan-branching enzyme
  • REFSEQ: glycogen branching enzyme
  • PATRIC: 14-alpha-glucan (glycogen) branching enzyme GH-13-type (EC 2.4.1.18)
  • TUBERCULIST: 14-alpha-glucan branching enzyme GlgB (glycogen branching enzyme)
  • NCBI: 1,4-alpha-glucan branching enzyme GlgB (glycogen branching enzyme)
  • updated information (H37Rv4):
    • gene name: glgB
    • function:
    • reference:
• Type: Not Target
• Start: 1490117
• End: 1492312
• Operon:


• Trans-membrane region:
  
• Role: II.A.8 - Polysaccharides (cytoplasmic)
• GO terms:
  • GO:0102752 - 1,4-alpha-glucan branching enzyme activity (using a glucosylated glycogenin as primer for glycogen synthesis) (Uniprot)
  • GO:0045227 - capsule polysaccharide biosynthetic process (Uniprot)
  • GO:0043169 - cation binding (Uniprot)
  • GO:0040007 - growth (Uniprot)
  • GO:0016757 - transferase activity, transferring glycosyl groups (Uniprot)
  • GO:0016740 - transferase activity (Uniprot)
  • GO:0009250 - glucan biosynthetic process (Uniprot)
  • GO:0005978 - glycogen biosynthetic process (Uniprot)
  • GO:0005977 - glycogen metabolic process (Uniprot)
  • GO:0005975 - carbohydrate metabolic process (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005515 - protein binding (Uniprot)
  • GO:0004553 - hydrolase activity, hydrolyzing O-glycosyl compounds (Uniprot)
  • GO:0003844 - 1,4-alpha-glucan branching enzyme activity (Uniprot)
  • GO:0003824 - catalytic activity (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • LINEAR-GLUCAN[c] -> GLYCOGEN[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure: 3k1d
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  3K1D	100%	Mycobacterium tuberculosis	Crystal structure of glycogen branching enzyme synonym: 1,4-alpha-D-glucan:1,4-alpha-D-GLUCAN 6-glucosyl-transferase from mycobacterium tuberculosis H37RV
  6JOY	53%	Rhodothermus marinus	The X-ray Crystallographic Structure of Branching Enzyme from Rhodothermus obamensis STB05
  5E70	51%	Escherichia coli O139:H28 (strain E24377A / ETEC)	Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin
  5E6Z	51%	Escherichia coli O139:H28 (strain E24377A / ETEC)	Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin
  5E6Y	51%	Escherichia coli O139:H28 (strain E24377A / ETEC)	Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin
  4LQ1	51%	Escherichia coli	Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose
  4LPC	51%	Escherichia coli	Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose
  1M7X	51%	Escherichia coli	The X-ray Crystallographic Structure of Branching Enzyme
  6KLF	44%	Crocosphaera subtropica ATCC 51142	Crystal structure of branching enzyme D434A mutant from Cyanothece sp. ATCC 51142
  5GR6	44%	Cyanothece sp. (strain ATCC 51142)	Crystal structure of branching enzyme Y500A/D501A double mutant from Cyanothece sp. ATCC 51142

• Links to additional information on glgB:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -11.661 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology
  • Photo of spot titer

Amino Acid Sequence

MSRSEKLTGEHLAPEPAEMARLVAGTHHNPHGILGAHEYDDHTVIRAFRPHAVEVVALVGKDRFSLQHLDSGLFAVALPFVDLIDYRLQVTYEGCEPHTV
ADAYRFLPTLGEVDLHLFAEGRHERLWEVLGAHPRSFTTADGVVSGVSFAVWAPNAKGVSLIGEFNGWNGHEAPMRVLGPSGVWELFWPDFPCDGLYKFR
VHGADGVVTDRADPFAFGTEVPPQTASRVTSSDYTWGDDDWMAGRALRNPVNEAMSTYEVHLGSWRPGLSYRQLARELTDYIVDQGFTHVELLPVAEHPF
AGSWGYQVTSYYAPTSRFGTPDDFRALVDALHQAGIGVIVDWVPAHFPKDAWALGRFDGTPLYEHSDPKRGEQLDWGTYVFDFGRPEVRNFLVANALYWL
QEFHIDGLRVDAVASMLYLDYSRPEGGWTPNVHGGRENLEAVQFLQEMNATAHKVAPGIVTIAEESTPWSGVTRPTNIGGLGFSMKWNMGWMHDTLDYVS
RDPVYRSYHHHEMTFSMLYAFSENYVLPLSHDEVVHGKGTLWGRMPGNNHVKAAGLRSLLAYQWAHPGKQLLFMGQEFGQRAEWSEQRGLDWFQLDENGF
SNGIQRLVRDINDIYRCHPALWSLDTTPEGYSWIDANDSANNVLSFMRYGSDGSVLACVFNFAGAEHRDYRLGLPRAGRWREVLNTDATIYHGSGIGNLG
GVDATDDPWHGRPASAVLVLPPTSALWLTPA

Additional Information

Analysis of Positive Selection in Clinical Isolates *new*

• Analysis of dN/dS (omega) in two collections of Mtb clinical isolates using GenomegaMap (Window model) (see description of methods)
  • Moldova: 2,057 clinical isolates
  • global set: 5,195 clinical isolates from 15 other countries
• In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
• A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.

	Moldova (2,057)	global set (5,195)
under significant positive selection?	NO	NO
omega peak height (95%CI lower bound)	2.02 (0.38)	1.92 (0.87)
codons under selection
omega plots
genetic variants	link	link
statistics at each codon	link	link