TB Genome Annotation Portal

Rv1310 (atpD)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: ATP synthase subunit beta
  • REFSEQ: F0F1 ATP synthase subunit beta
  • PATRIC: ATP synthase beta chain (EC 3.6.3.14)
  • TUBERCULIST: Probable ATP synthase beta chain AtpD
  • NCBI: Probable ATP synthase beta chain AtpD
  • updated information (H37Rv4):
    • gene name: atpD
    • function:
    • reference:
• Type: Not Target
• Start: 1465841
• End: 1467301
• Operon:


• Trans-membrane region:
  
• Role: I.B.8 - ATP-proton motive force
• GO terms:
  • GO:0099132 - ATP hydrolysis coupled cation transmembrane transport (Uniprot)
  • GO:0046933 - proton-transporting ATP synthase activity, rotational mechanism (Uniprot)
  • GO:0046034 - ATP metabolic process (Uniprot)
  • GO:0045261 - proton-transporting ATP synthase complex, catalytic core F(1) (Uniprot)
  • GO:0040007 - growth (Uniprot)
  • GO:0016787 - hydrolase activity (Uniprot)
  • GO:0016020 - membrane (Uniprot)
  • GO:0015986 - ATP synthesis coupled proton transport (Uniprot)
  • GO:0006811 - ion transport (Uniprot)
  • GO:0006754 - ATP biosynthetic process (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005829 - cytosol (Uniprot)
  • GO:0005618 - cell wall (Uniprot)
  • GO:0005576 - extracellular region (Uniprot)
  • GO:0005524 - ATP binding (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • 4 H[c] + ADP[c] + PI[c] <=> ATP[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  7JGA	92%	Mycolicibacterium smegmatis	Cryo-EM structure of bedaquiline-saturated Mycobacterium smegmatis ATP synthase rotational state 3
  7JG9	92%	Mycolicibacterium smegmatis	Cryo-EM structure of bedaquiline-saturated mycobacterium smegmatis ATP synthase rotational state 2 (backbone model)
  7JG8	92%	Mycolicibacterium smegmatis	Cryo-EM structure of bedaquiline-saturated Mycobacterium smegmatis ATP synthase rotational state 1 (backbone model)
  7JG7	92%	Mycolicibacterium smegmatis	Cryo-EM structure of bedaquiline-free Mycobacterium smegmatis ATP synthase rotational state 3 (backbone model)
  7JG6	92%	Mycolicibacterium smegmatis	Cryo-EM structure of bedaquiline-free Mycobacterium smegmatis ATP synthase rotational state 2 (backbone model)
  7JG5	92%	Mycolicibacterium smegmatis	Cryo-EM structure of bedaquiline-free Mycobacterium smegmatis ATP synthase rotational state 1
  6FOC	92%	Mycolicibacterium smegmatis MC2 155	F1-ATPase from Mycobacterium smegmatis
  6N30	65%	Bacillus sp. (strain PS3)	Bacillus PS3 ATP synthase class 3
  6N2Z	65%	Bacillus sp. (strain PS3)	Bacillus PS3 ATP synthase class 2
  6N2Y	65%	Bacillus sp. (strain PS3)	Bacillus PS3 ATP synthase class 1

• Links to additional information on atpD:
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -8.575 (from Jeremy Rock's lab)

Amino Acid Sequence

MTTTAEKTDRPGKPGSSDTSGRVVRVTGPVVDVEFPRGSIPELFNALHAEITFESLAKTLTLEVAQHLGDNLVRTISLQPTDGLVRGVEVIDTGRSISVP
VGEGVKGHVFNALGDCLDEPGYGEKFEHWSIHRKPPAFEELEPRTEMLETGLKVVDLLTPYVRGGKIALFGGAGVGKTVLIQEMINRIARNFGGTSVFAG
VGERTREGNDLWVELAEANVLKDTALVFGQMDEPPGTRMRVALSALTMAEWFRDEQGQDVLLFIDNIFRFTQAGSEVSTLLGRMPSAVGYQPTLADEMGE
LQERITSTRGRSITSMQAVYVPADDYTDPAPATTFAHLDATTELSRAVFSKGIFPAVDPLASSSTILDPSVVGDEHYRVAQEVIRILQRYKDLQDIIAIL
GIDELSEEDKQLVNRARRIERFLSQNMMAAEQFTGQPGSTVPVKETIEAFDRLCKGDFDHVPEQAFFLIGGLDDLAKKAESLGAKL

Additional Information