TB Genome Annotation Portal

Rv1305 (atpE)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: ATP synthase subunit C
  • REFSEQ: F0F1 ATP synthase subunit C
  • PATRIC: ATP synthase C chain (EC 3.6.3.14)
  • TUBERCULIST: Probable ATP synthase C chain AtpE (lipid-binding protein) (dicyclohexylcarbodiimide-binding protein)
  • NCBI: Probable ATP synthase C chain AtpE (lipid-binding protein) (dicyclohexylcarbodiimide-binding protein)
  • updated information (H37Rv4):
    • gene name: atpE
    • function:
    • reference:
• Type: Not Target
• Start: 1461045
• End: 1461290
• Operon:


• Trans-membrane region:
  
• Role: I.B.8 - ATP-proton motive force
• GO terms:
  • GO:0046933 - proton-transporting ATP synthase activity, rotational mechanism (Uniprot)
  • GO:0045263 - proton-transporting ATP synthase complex, coupling factor F(o) (Uniprot)
  • GO:0040007 - growth (Uniprot)
  • GO:0033177 - proton-transporting two-sector ATPase complex, proton-transporting domain (Uniprot)
  • GO:0016021 - integral component of membrane (Uniprot)
  • GO:0016020 - membrane (Uniprot)
  • GO:0015991 - ATP hydrolysis coupled proton transport (Uniprot)
  • GO:0015986 - ATP synthesis coupled proton transport (Uniprot)
  • GO:0015078 - proton transmembrane transporter activity (Uniprot)
  • GO:0008289 - lipid binding (Uniprot)
  • GO:0006811 - ion transport (Uniprot)
  • GO:0006754 - ATP biosynthetic process (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • 4 H[c] + ADP[c] + PI[c] <=> ATP[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  7JGC	90%	Mycolicibacterium smegmatis	Cryo-EM structure of bedaquiline-saturated Mycobacterium smegmatis ATP synthase FO region
  7JGB	90%	Mycolicibacterium smegmatis	Cryo-EM structure of bedaquiline-free Mycobacterium smegmatis ATP synthase FO region
  7JGA	90%	Mycolicibacterium smegmatis	Cryo-EM structure of bedaquiline-saturated Mycobacterium smegmatis ATP synthase rotational state 3
  7JG9	90%	Mycolicibacterium smegmatis	Cryo-EM structure of bedaquiline-saturated mycobacterium smegmatis ATP synthase rotational state 2 (backbone model)
  7JG8	90%	Mycolicibacterium smegmatis	Cryo-EM structure of bedaquiline-saturated Mycobacterium smegmatis ATP synthase rotational state 1 (backbone model)
  7JG7	90%	Mycolicibacterium smegmatis	Cryo-EM structure of bedaquiline-free Mycobacterium smegmatis ATP synthase rotational state 3 (backbone model)
  7JG6	90%	Mycolicibacterium smegmatis	Cryo-EM structure of bedaquiline-free Mycobacterium smegmatis ATP synthase rotational state 2 (backbone model)
  7JG5	90%	Mycolicibacterium smegmatis	Cryo-EM structure of bedaquiline-free Mycobacterium smegmatis ATP synthase rotational state 1
  4V1H	90%	MYCOBACTERIUM PHLEI	Crystal structure of a mycobacterial ATP synthase rotor ring in complex with Iodo-Bedaquiline
  4V1G	90%	MYCOBACTERIUM PHLEI	Crystal structure of a mycobacterial ATP synthase rotor ring

• Links to additional information on atpE:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -8.676 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MDPTIAAGALIGGGLIMAGGAIGAGIGDGVAGNALISGVARQPEAQGRLFTPFFITVGLVEAAYFINLAFMALFVFATPVK

Additional Information