TB Genome Annotation Portal

Rv1285 (cysD)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: sulfate adenylyltransferase subunit 2
  • REFSEQ: sulfate adenylyltransferase subunit 2
  • PATRIC: Sulfate adenylyltransferase subunit 2 (EC 2.7.7.4)
  • TUBERCULIST: Probable sulfate adenylyltransferase subunit 2 CysD
  • NCBI: Probable sulfate adenylyltransferase subunit 2 CysD
  • updated information (H37Rv4):
    • gene name: cysD
    • function:
    • reference:
• Coordinates in H37Rv: 1437909 - 1438907
• Gene length: 999 bp (with stop codon), 332 aa (without stop codon)
• Operon:


• Trans-membrane region:
  
• Role: I.C.5 - Sulphur metabolism
• GO terms:
  • GO:0070814 - hydrogen sulfide biosynthetic process (Uniprot)
  • GO:0040007 - growth (Uniprot)
  • GO:0034599 - cellular response to oxidative stress (Uniprot)
  • GO:0019419 - sulfate reduction (Uniprot)
  • GO:0016779 - nucleotidyltransferase activity (Uniprot)
  • GO:0016740 - transferase activity (Uniprot)
  • GO:0010438 - cellular response to sulfur starvation (Uniprot)
  • GO:0010134 - sulfate assimilation via adenylyl sulfate reduction (Uniprot)
  • GO:0009336 - sulfate adenylyltransferase complex (ATP) (Uniprot)
  • GO:0008152 - metabolic process (Uniprot)
  • GO:0005829 - cytosol (Uniprot)
  • GO:0005524 - ATP binding (Uniprot)
  • GO:0004781 - sulfate adenylyltransferase (ATP) activity (Uniprot)
  • GO:0003824 - catalytic activity (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
  • GO:0000103 - sulfate assimilation (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • ATP[c] + SLF[c] -> PPI[c] + APS[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Latest Homologs in PDB
• Top 10 Homologs in PDB (as of Apr 2026):
  

  PDB	aa ident	species	PDB title
  1ZUN	50%	Pseudomonas syringae	Crystal Structure of a GTP-Regulated ATP Sulfurylase Heterodimer from Pseudomonas syringae

• Links to additional information on cysD:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 1.233 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MAITINMVNPTGFIRYEDVEQEAMTSDVTVGPAPGQYQLSHLRLLEAEAIHVIREVAAEFERPVLLFSGGKDSIVMLHLALKAFRPGRLPFPVMHVDTGH
NFDEVIATRDELVAAAGVRLVVASVQDDIDAGRVVETIPSRNPIQTVTLLRAIRENQFDAAFGGARRDEEKARAKERVFSFRDEFGQWDPKAQRPELWNL
YNGRHHKGEHIRVFPLSNWTEFDIWSYIGAEQVRLPSIYFAHRRKVFQRDGMLLAVHRHMQPRADEPVFEATVRFRTVGDVTCTGCVESSASTVAEVIAE
TAVARLTERGATRADDRISEAGMEDRKRQGYF

Additional Information

Analysis of Positive Selection in Clinical Isolates *new*

• data from Culviner et al (2025) (55,259 Mtb clinical isolates)
  • overall pN/pS for Rv1285: 0.830634668
  • lineage-specific pN/pS in L1: 0.465381053
  • lineage-specific pN/pS in L2: 1.479673093
  • lineage-specific pN/pS in L3: 1.048101774
  • lineage-specific pN/pS in L4: 0.858738849

• Analysis of dN/dS (omega) in a global collection of 10k Mtb clinical isolates using GenomegaMap (Window model)
• clinical isolates collection: global set of 10,626 Mtb genomes
• In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
• A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.

	global set of 10,626 Mtb clinical isolates
under significant positive selection?	YES
omega peak height (95%CI lower bound)	2.63 (1.38)
codons under selection	1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22
omega plots
genetic variants*	link