TB Genome Annotation Portal

Rv1285 (cysD)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: sulfate adenylyltransferase subunit 2
  • REFSEQ: sulfate adenylyltransferase subunit 2
  • PATRIC: Sulfate adenylyltransferase subunit 2 (EC 2.7.7.4)
  • TUBERCULIST: Probable sulfate adenylyltransferase subunit 2 CysD
  • NCBI: Probable sulfate adenylyltransferase subunit 2 CysD
  • updated information (H37Rv4):
    • gene name: cysD
    • function:
    • reference:
• Type: Not Target
• Start: 1437909
• End: 1438907
• Operon:


• Trans-membrane region:
  
• Role: I.C.5 - Sulphur metabolism
• GO terms:
  • GO:0070814 - hydrogen sulfide biosynthetic process (Uniprot)
  • GO:0040007 - growth (Uniprot)
  • GO:0034599 - cellular response to oxidative stress (Uniprot)
  • GO:0019419 - sulfate reduction (Uniprot)
  • GO:0016779 - nucleotidyltransferase activity (Uniprot)
  • GO:0016740 - transferase activity (Uniprot)
  • GO:0010438 - cellular response to sulfur starvation (Uniprot)
  • GO:0010134 - sulfate assimilation via adenylyl sulfate reduction (Uniprot)
  • GO:0009336 - sulfate adenylyltransferase complex (ATP) (Uniprot)
  • GO:0008152 - metabolic process (Uniprot)
  • GO:0005829 - cytosol (Uniprot)
  • GO:0005524 - ATP binding (Uniprot)
  • GO:0004781 - sulfate adenylyltransferase (ATP) activity (Uniprot)
  • GO:0003824 - catalytic activity (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
  • GO:0000103 - sulfate assimilation (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • ATP[c] + SLF[c] -> PPI[c] + APS[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  1ZUN	50%	Pseudomonas syringae	Crystal Structure of a GTP-Regulated ATP Sulfurylase Heterodimer from Pseudomonas syringae

• Links to additional information on cysD:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 1.233 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MAITINMVNPTGFIRYEDVEQEAMTSDVTVGPAPGQYQLSHLRLLEAEAIHVIREVAAEFERPVLLFSGGKDSIVMLHLALKAFRPGRLPFPVMHVDTGH
NFDEVIATRDELVAAAGVRLVVASVQDDIDAGRVVETIPSRNPIQTVTLLRAIRENQFDAAFGGARRDEEKARAKERVFSFRDEFGQWDPKAQRPELWNL
YNGRHHKGEHIRVFPLSNWTEFDIWSYIGAEQVRLPSIYFAHRRKVFQRDGMLLAVHRHMQPRADEPVFEATVRFRTVGDVTCTGCVESSASTVAEVIAE
TAVARLTERGATRADDRISEAGMEDRKRQGYF

Additional Information