TB Genome Annotation Portal

Rv1281c (oppD)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: oligopeptide/dipeptide ABC transporter ATP-binding protein
  • REFSEQ: oligopeptide-transport ATP-binding protein ABC transporter OppD
  • PATRIC: Oligopeptide transport system permease protein OppD (TC 3.A.1.5.1)
  • TUBERCULIST: Probable oligopeptide-transport ATP-binding protein ABC transporter OppD
  • NCBI: Probable oligopeptide-transport ATP-binding protein ABC transporter OppD
  • updated information (H37Rv4):
    • gene name: oppD
    • function:
    • reference:
• Type: Not Target
• Start: 1433433
• End: 1435271
• Operon:


• Trans-membrane region:
  
• Role: III.A.1 - Amino acids
• GO terms:
  • GO:0052060 - evasion or tolerance by symbiont of host-produced nitric oxide (Uniprot)
  • GO:0016887 - ATPase activity (Uniprot)
  • GO:0015833 - peptide transport (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005618 - cell wall (Uniprot)
  • GO:0005524 - ATP binding (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  3UX8	47%	Geobacillus	Crystal structure of UvrA
  3UWX	47%	Geobacillus	Crystal structure of UvrA-UvrB complex
  2R6F	47%	Geobacillus stearothermophilus	Crystal Structure of Bacillus stearothermophilus UvrA
  6Z67	38%	Streptococcus pneumoniae	FtsE structure of Streptococcus pneumoniae in complex with AMPPNP at 2.4 A resolution
  6Z63	38%	Streptococcus pneumoniae	FtsE structure from Streptococus pneumoniae in complex with ADP at 1.57 A resolution (spacegroup P 21)
  6Z4W	38%	Streptococcus pneumoniae	FtsE structure from Streptococcus pneumoniae in complex with ADP (space group P 1)
  3DHW	37%	Escherichia coli	Crystal structure of methionine importer MetNI
  6CVL	37%	Escherichia coli (strain K12)	Crystal structure of the Escherichia coli ATPgS-bound MetNI methionine ABC transporter in complex with its MetQ binding protein
  3TUZ	37%	Escherichia coli	Inward facing conformations of the MetNI methionine ABC transporter: CY5 SeMet soak crystal form
  3TUJ	37%	Escherichia coli	Inward facing conformations of the MetNI methionine ABC transporter: DM crystal form

• Links to additional information on oppD:
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 1.362 (from Jeremy Rock's lab)

Amino Acid Sequence

MSPLLEVTDLAVTFRTDGDPVTAVRGISYRVEPGEVVAMVGESGSGKSAAAMAVVGLLPEYAQVRGSVRLQGTELLGLADNAMSRFRGKAIGTVFQDPMS
ALTPVYTVGDQIAEAIEVHQPRVGKKAARRRAVELLDLVGISQPQRRSRAFPHELSGGERQRVVIAIAIANDPDLLICDEPTTALDVTVQAQILDVLKAA
RDVTGAGVLIITHDLGVVAEFADRALVMYAGRVVESAGVNDLYRDRRMPYTVGLLGSVPRLDAAQGTRLVPIPGAPPSLAGLAPGCPFAPRCPLVIDECL
TAEPELLDVATDHRAACIRTELVTGRSAADIYRVKTEARPAALGDASVVVRVRHLVKTYRLAKGVVLRRAIGEVRAVDGISLELRQGRTLGIVGESGSGK
STTLHEILELAAPQSGSIEVLGTDVATLGTAERRSLRRDIQVVFQDPVASLDPRLPVFDLIAEPLQANGFGKNETHARVAELLDIVGLRHGDASRYPAEF
SGGQKQRIGIARALALQPKILALDEPVSALDVSIQAGIINLLLDLQEQFGLSYLFVSHDLSVVKHLAHQVAVMLAGTVVEQGDSEEVFGNPKHEYTRRLL
GAVPQPDPARRG

Additional Information