Rv1267c (embR)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: transcriptional regulator embR
- REFSEQ: transcriptional regulatory protein EMBR
- PATRIC: Transcriptional regulatory protein EmbR
- TUBERCULIST: Probable transcriptional regulatory protein EmbR
- NCBI: Probable transcriptional regulatory protein EmbR
- updated information (H37Rv4):
  - gene name: embR
  - function:
  - reference:
Type: Not Target
Start: 1416181
End: 1417347
Operon:

Trans-membrane region:
Role: I.J.1 - Repressors/activators
GO terms:
- GO:0016887 - ATPase activity (Uniprot)
- GO:0006355 - regulation of transcription, DNA-templated (Uniprot)
- GO:0006351 - transcription, DNA-templated (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
- GO:0005622 - intracellular (Uniprot)
- GO:0005618 - cell wall (Uniprot)
- GO:0003924 - GTPase activity (Uniprot)
- GO:0003677 - DNA binding (Uniprot)
- GO:0000160 - phosphorelay signal transduction system (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure: 2ff4, 2fez
Search for Homologs in PDB

Top 10 Homologs in PDB (as of Nov 2020):

PDB	aa ident	species	PDB title
2FF4	100%	Mycobacterium tuberculosis	Mycobacterium tuberculosis EmbR in complex with low affinity phosphopeptide
2FEZ	100%	Mycobacterium tuberculosis	Mycobacterium tuberculosis EmbR
6CAH	43%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	NMR-based structure of the FHA-2 domain from Mycobacterium tuberculosis ABC transporter Rv1747
6I2S	38%	Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)	Crystal structure of the SucA domain of Mycobacterium smegmatis KGD (R802A) in complex with GarA, following 2-oxoglutarate soak
6I2R	38%	Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)	Crystal structure of the SucA domain of Mycobacterium smegmatis KGD (alpha-ketoglutarate decarboxylase), mutant R802A, in complex with GarA
6I2Q	38%	Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)	Crystal structure of the wild-type SucA domain of Mycobacterium smegmatis KGD (alpha-ketoglutarate decarboxylase), in complex with GarA
6I2P	38%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Crystal structure of the Mycobacterium tuberculosis PknB kinase domain (L33E mutant) in complex with its substrate GarA
2KKL	38%	Mycobacterium bovis	Solution NMR structure of FHA domain of Mb1858 from Mycobacterium bovis. Northeast Structural Genomics Consortium Target MbR243C (24-155).
2KFU	38%	Mycobacterium tuberculosis	PknB-phosphorylated Rv1827

Links to additional information on embR:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 0.792 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

MAGSATVEKRLDFGLLGPLQMTIDGTPVPSGTPKQRAVLAMLVINRNRPVGVDALITALWEEWPPSGARASIHSYVSNLRKLLGGAGIDPRVVLAAAPPG
YRLSIPDNTCDLGRFVAEKTAGVHAAAAGRFEQASRHLSAALREWRGPVLDDLRDFQFVEPFATALVEDKVLAHTAKAEAEIACGRASAVIAELEALTFE
HPYREPLWTQLITAYYLSDRQSDALGAYRRVKTTLADDLGIDPGPTLRALNERILRQQPLDAKKSAKTTAAGTVTVLDQRTMASGQQAVAYLHDIASGRG
YPLQAAATRIGRLHDNDIVLDSANVSRHHAVIVDTGTNYVINDLRSSNGVHVQHERIRSAVTLNDGDHIRICDHEFTFQISAGTHGGT

(Nucleotide sequence available on KEGG)

Additional Information

Analysis of Positive Selection in Clinical Isolates new

Analysis of dN/dS (omega) in two collections of Mtb clinical isolates using GenomegaMap (Window model) (see description of methods)
- Moldova: 2,057 clinical isolates
- global set: 5,195 clinical isolates from 15 other countries
In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.

	Moldova (2,057)	global set (5,195)
under significant positive selection?	NO	NO
omega peak height (95%CI lower bound)	1.72 (0.23)	1.88 (0.89)
codons under selection
omega plots
genetic variants*	link	link
statistics at each codon	link	link

* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv1267c/embR, gene len: 1166 bp, num TA sites: 21

condition	dataset	call	medium	method	notes
in-vitro	DeJesus 2017 mBio	non-essential	7H9	HMM	fully saturated, 14 TnSeq libraries combined
in-vitro	Sassetti 2003 Mol Micro	non-essential	7H9	TRASH	essential if hybridization ratio<0.2
in-vivo (mice)	Sassetti 2003 PNAS	non-essential	BL6 mice	TRASH	essential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)	Griffin 2011 PPath	non-essential	M9 minimal+glycerol	Gumbel	2 replicates; Padj<0.05
in-vitro (cholesterol)	Griffin 2011 PPath	non-essential	M9 minimal+cholesterol	Gumbel	3 replicates; Padj<0.05
differentially essential in cholesterol	Griffin 2011 PPath	NO (LFC=-0.15)	cholesterol vs glycerol	resampling-SR	YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitro	Smith 2022 eLife	non-essential	7H9	HMM	6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)	Smith 2022 eLife	non-essential	BL6 mice	HMM	6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in mice	Smith 2022 eLife	NO (LFC=0.356)	in-vivo vs in-vitro	ZINB	YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)	Minato 2019 mSys	non-essential	minimal medium	HMM
in-vitro (YM rich medium)	Minato 2019 mSys	non-essential	YM rich medium	HMM	7H9 supplemented with ~20 metabolites (amino acids, vitamins)
differentially essential in YM rich medium	Minato 2019 mSys	NO (LFC=0.15)	YM rich vs minimal medium	resampling

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0691c (-) (Direct binding)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Rv1267c (embR)
- Rv1405c (-)
Upregulated by:
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Not downregulated by other genes.

TBCAP

Tubculosis Community Annotation Project (

Slayden et al., 2013

Rv1267c (embR)

Property	Value	Creator	Evidence	PMID	Comment
Interaction	Regulatory Rv3795	ashwinigbhat	IEP		Co-expression (Functional linkage) VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001
Interaction	Regulatory Rv3795	ashwinigbhat	IEP		Co-expression (Functional linkage) authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007
Interaction	Regulatory Rv3795	ashwinigbhat	IEP		Co-expression (Functional linkage) AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008
Interaction	Regulatory Rv3795	priti.priety	IEP		Co-expression (Functional linkage) VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001
Interaction	Regulatory Rv3795	priti.priety	IEP		Co-expression (Functional linkage) authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007
Interaction	Regulatory Rv3795	priti.priety	IEP		Co-expression (Functional linkage) AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008
Interaction	Regulatory Rv3794	ashwinigbhat	IDA		Affinity purification (Physical interaction) VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001
Interaction	Regulatory Rv3794	ashwinigbhat	IDA		Affinity purification (Physical interaction) authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007
Interaction	Regulatory Rv3794	ashwinigbhat	IDA		Affinity purification (Physical interaction) AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008
Interaction	Regulatory Rv3794	priti.priety	IDA		Affinity purification (Physical interaction) VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001
Interaction	Regulatory Rv3794	priti.priety	IDA		Affinity purification (Physical interaction) authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007
Interaction	Regulatory Rv3794	priti.priety	IDA		Affinity purification (Physical interaction) AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008
Citation	Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis. LJ. Alderwick, V. Molle et al. Proc. Natl. Acad. Sci. U.S.A. 2006	shruti4rana	IDA	16477027	Structural Analysis
Interaction	Signaling Rv1266c	shruti4rana	IDA		Structural Analysis LJ. Alderwick, V. Molle et al. Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2006
Citation	Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. K. Sharma, M. Gupta et al. J. Bacteriol. 2006	shruti4rana	IDA	16585755	Structural Analysis
Interaction	Signaling Rv1266c	shruti4rana	IDA		Structural Analysis K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006
Citation	Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. K. Sharma, M. Gupta et al. J. Bacteriol. 2006	priyadarshinipriyanka2001	IDA	16585755	Band Shift
Interaction	Regulatory Rv3794	priyadarshinipriyanka2001	IDA		Band Shift K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006
Interaction	Regulatory Rv3795	priyadarshinipriyanka2001	IDA		Band Shift K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006
Interaction	Regulatory Rv3793	priyadarshinipriyanka2001	IDA		Band Shift K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006
Interaction	Activation Rv1266c	shahanup86	IPI		Affinity purification (Physical interaction) K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006
Citation	Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. K. Sharma, M. Gupta et al. J. Bacteriol. 2006	yamir.moreno	IEP	16585755	qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
Interaction	Regulates Rv3795	yamir.moreno	IEP		qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006
Citation	Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. K. Sharma, M. Gupta et al. J. Bacteriol. 2006	yamir.moreno	IDA	16585755	qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
Interaction	Regulates Rv3795	yamir.moreno	IDA		qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006
Citation	Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. K. Sharma, M. Gupta et al. J. Bacteriol. 2006	yamir.moreno	IDA	16585755	qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
Interaction	Regulates Rv3793	yamir.moreno	IDA		qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006
Citation	Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. K. Sharma, M. Gupta et al. J. Bacteriol. 2006	yamir.moreno	IEP	16585755	qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
Interaction	Regulates Rv3794	yamir.moreno	IEP		qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006
Citation	Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. K. Sharma, M. Gupta et al. J. Bacteriol. 2006	yamir.moreno	IDA	16585755	qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
Interaction	Regulates Rv3794	yamir.moreno	IDA		qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006
Interaction	RegulatedBy Rv1266c	yamir.moreno	IEP		qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006
Citation	Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. K. Sharma, M. Gupta et al. J. Bacteriol. 2006	yamir.moreno	IEP	16585755	qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
Interaction	Regulates Rv3793	yamir.moreno	IEP		qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	TAS	18985025	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
Interaction	Regulates Rv3794	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	TAS	18985025	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
Interaction	Regulates Rv3795	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv1266c	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation	The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008	yamir.moreno	TAS	18985025	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
Interaction	Regulates Rv3793	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv3286c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Name	Transcriptional regulator of the embCAB operon	mjackson	IMP		PIM, LM and LAM biosynthesis
Name	Transcriptional regulator of the embCAB operon	mjackson	IMP		Arabinosyltransferases
Other	TBPWY:PIM, LM and LAM biosynthesis	mjackson			Transcriptional regulator of the embCAB operon (phenotypic [mycobacterial recombinant strains]) K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006
Citation	The embAB genes of Mycobacterium avium encode an arabinosyl transferase involved in cell wall arabinan biosynthesis that is the target for the antimycobacterial drug ethambutol. AE. Belanger, GS. Besra et al. Proc. Natl. Acad. Sci. U.S.A. 1996	mjackson		8876238	Transcriptional regulator of the embCAB operon (phenotypic [mycobacterial recombinant strains])
Other	TBPWY:PIM, LM and LAM biosynthesis	mjackson			Transcriptional regulator of the embCAB operon (phenotypic [mycobacterial recombinant strains]) AE. Belanger, GS. Besra et al. The embAB genes of Mycobacterium avium encode an arabinosyl transferase involved in cell wall arabinan biosynthesis that is the target for the antimycobacterial drug ethambutol. Proc. Natl. Acad. Sci. U.S.A. 1996
Citation	Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. K. Sharma, M. Gupta et al. J. Bacteriol. 2006	mjackson		16585755	Transcriptional regulator of the embCAB operon (phenotypic [mycobacterial recombinant strains])

Property

Value

Creator

Evidence

PMID

Comment

Interaction

Regulatory Rv3795

ashwinigbhat

IEP

Co-expression (Functional linkage)
VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001

Interaction

Regulatory Rv3795

ashwinigbhat

IEP

Co-expression (Functional linkage)
authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007

Interaction

Regulatory Rv3795

ashwinigbhat

IEP

Co-expression (Functional linkage)
AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008

Interaction

Regulatory Rv3795

priti.priety

IEP

Interaction

Regulatory Rv3795

priti.priety

IEP

Interaction

Regulatory Rv3795

priti.priety

IEP

Co-expression (Functional linkage)
AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008

Interaction

Regulatory Rv3794

ashwinigbhat

IDA

Affinity purification (Physical interaction)
VE. Escuyer, MA. Lety et al. The role of the embA and embB gene products in the biosynthesis of the terminal hexaarabinofuranosyl motif of Mycobacterium smegmatis arabinogalactan. J. Biol. Chem. 2001

Interaction

Regulatory Rv3794

ashwinigbhat

IDA

Affinity purification (Physical interaction)
authors,LJ. Alderwick,HL. Birch,AK. Mishra,L. Eggeling,GS. Besra Structure, function and biosynthesis of the Mycobacterium tuberculosis cell wall: arabinogalactan and lipoarabinomannan assembly with a view to discovering new drug targets. Biochem. Soc. Trans. 2007

Interaction

Regulatory Rv3794

ashwinigbhat

IDA

Affinity purification (Physical interaction)
AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008

Interaction

Regulatory Rv3794

priti.priety

IDA

Interaction

Regulatory Rv3794

priti.priety

IDA

Interaction

Regulatory Rv3794

priti.priety

IDA

Affinity purification (Physical interaction)
AG. Amin, R. Goude et al. EmbA is an essential arabinosyltransferase in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2008

Citation

Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis. LJ. Alderwick, V. Molle et al. Proc. Natl. Acad. Sci. U.S.A. 2006

shruti4rana

IDA

16477027

Structural Analysis

Interaction

Signaling Rv1266c

shruti4rana

IDA

Structural Analysis
LJ. Alderwick, V. Molle et al. Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2006

Citation

Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. K. Sharma, M. Gupta et al. J. Bacteriol. 2006

shruti4rana

IDA

16585755

Structural Analysis

Interaction

Signaling Rv1266c

shruti4rana

IDA

Structural Analysis
K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006

Citation

Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. K. Sharma, M. Gupta et al. J. Bacteriol. 2006

priyadarshinipriyanka2001

IDA

16585755

Band Shift

Interaction

Regulatory Rv3794

priyadarshinipriyanka2001

IDA

Band Shift
K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006

Interaction

Regulatory Rv3795

priyadarshinipriyanka2001

IDA

Band Shift
K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006

Interaction

Regulatory Rv3793

priyadarshinipriyanka2001

IDA

Band Shift
K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006

Interaction

Activation Rv1266c

shahanup86

IPI

Affinity purification (Physical interaction)
K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006

Citation

Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. K. Sharma, M. Gupta et al. J. Bacteriol. 2006

yamir.moreno

IEP

16585755

Interaction

Regulates Rv3795

yamir.moreno

IEP

qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006

Citation

Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. K. Sharma, M. Gupta et al. J. Bacteriol. 2006

yamir.moreno

IDA

16585755

Interaction

Regulates Rv3795

yamir.moreno

IDA

Citation

Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. K. Sharma, M. Gupta et al. J. Bacteriol. 2006

yamir.moreno

IDA

16585755

Interaction

Regulates Rv3793

yamir.moreno

IDA

Citation

Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. K. Sharma, M. Gupta et al. J. Bacteriol. 2006

yamir.moreno

IEP

16585755

Interaction

Regulates Rv3794

yamir.moreno

IEP

Citation

Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. K. Sharma, M. Gupta et al. J. Bacteriol. 2006

yamir.moreno

IDA

16585755

Interaction

Regulates Rv3794

yamir.moreno

IDA

Interaction

RegulatedBy Rv1266c

yamir.moreno

IEP

qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006

Citation

Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. K. Sharma, M. Gupta et al. J. Bacteriol. 2006

yamir.moreno

IEP

16585755

Interaction

Regulates Rv3793

yamir.moreno

IEP

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

TAS

18985025

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.

Interaction

Regulates Rv3794

yamir.moreno

TAS

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

TAS

18985025

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.

Interaction

Regulates Rv3795

yamir.moreno

TAS

Interaction

RegulatedBy Rv1266c

yamir.moreno

TAS

Citation

The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008

yamir.moreno

TAS

18985025

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.

Interaction

Regulates Rv3793

yamir.moreno

TAS

Interaction

RegulatedBy Rv3286c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007

Name

Transcriptional regulator of the embCAB operon

mjackson

IMP

PIM, LM and LAM biosynthesis

Name

Transcriptional regulator of the embCAB operon

mjackson

IMP

Arabinosyltransferases

Other

TBPWY:PIM, LM and LAM biosynthesis

mjackson

Transcriptional regulator of the embCAB operon (phenotypic [mycobacterial recombinant strains])
K. Sharma, M. Gupta et al. Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. J. Bacteriol. 2006

Citation

The embAB genes of Mycobacterium avium encode an arabinosyl transferase involved in cell wall arabinan biosynthesis that is the target for the antimycobacterial drug ethambutol. AE. Belanger, GS. Besra et al. Proc. Natl. Acad. Sci. U.S.A. 1996

mjackson

8876238

Transcriptional regulator of the embCAB operon (phenotypic [mycobacterial recombinant strains])

Other

TBPWY:PIM, LM and LAM biosynthesis

mjackson

Transcriptional regulator of the embCAB operon (phenotypic [mycobacterial recombinant strains])
AE. Belanger, GS. Besra et al. The embAB genes of Mycobacterium avium encode an arabinosyl transferase involved in cell wall arabinan biosynthesis that is the target for the antimycobacterial drug ethambutol. Proc. Natl. Acad. Sci. U.S.A. 1996

Citation

Transcriptional control of the mycobacterial embCAB operon by PknH through a regulatory protein, EmbR, in vivo. K. Sharma, M. Gupta et al. J. Bacteriol. 2006

mjackson

16585755

Transcriptional regulator of the embCAB operon (phenotypic [mycobacterial recombinant strains])

Comments

TB Genome Annotation Portal

Rv1267c (embR)

Amino Acid Sequence

Additional Information

Analysis of Positive Selection in Clinical Isolates *new*

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

Interactions based on ChIPSeq data

Interactions based on ChIPSeq data (Minch et al. 2014)

Interactions based on TFOE data (Rustad et al. 2014)

TBCAP

Comments

Analysis of Positive Selection in Clinical Isolates new