Rv1248c (-)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: 2-oxoglutarate decarboxylase
- REFSEQ: alpha-ketoglutarate decarboxylase
- PATRIC: Dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex (EC 2.3.1.61) / 2-oxoglutarate dehydrogenase E1 component (EC 1.2.4.2)
- TUBERCULIST: Multifunctional alpha-ketoglutarate metabolic enzyme
- NCBI: Multifunctional alpha-ketoglutarate metabolic enzyme
- updated information (H37Rv4):
  - gene name: kgd/HOAS
  - function: also known as HOAS
  - reference: de Carvalho (2010) PMID: 20416504; Maksymiuk et al (2015) PMID 26547230
Type: Not Target
Start: 1389357
End: 1393052
Operon:

Trans-membrane region:
Role: I.B.3 - TCA cycle
GO terms:
- GO:0055114 - oxidation-reduction process (Uniprot)
- GO:0050439 - 2-hydroxy-3-oxoadipate synthase activity (Uniprot)
- GO:0046872 - metal ion binding (Uniprot)
- GO:0045254 - pyruvate dehydrogenase complex (Uniprot)
- GO:0045252 - oxoglutarate dehydrogenase complex (Uniprot)
- GO:0040007 - growth (Uniprot)
- GO:0030976 - thiamine pyrophosphate binding (Uniprot)
- GO:0022900 - electron transport chain (Uniprot)
- GO:0016831 - carboxy-lyase activity (Uniprot)
- GO:0016829 - lyase activity (Uniprot)
- GO:0016746 - transferase activity, transferring acyl groups (Uniprot)
- GO:0016740 - transferase activity (Uniprot)
- GO:0016624 - oxidoreductase activity, acting on the aldehyde or oxo group of donors, disulfide as acceptor (Uniprot)
- GO:0016491 - oxidoreductase activity (Uniprot)
- GO:0009055 - electron transfer activity (Uniprot)
- GO:0008683 - 2-oxoglutarate decarboxylase activity (Uniprot)
- GO:0008152 - metabolic process (Uniprot)
- GO:0006103 - 2-oxoglutarate metabolic process (Uniprot)
- GO:0006099 - tricarboxylic acid cycle (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
- GO:0005829 - cytosol (Uniprot)
- GO:0005618 - cell wall (Uniprot)
- GO:0005515 - protein binding (Uniprot)
- GO:0004149 - dihydrolipoyllysine-residue succinyltransferase activity (Uniprot)
- GO:0003824 - catalytic activity (Uniprot)
- GO:0000287 - magnesium ion binding (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
- AKG[c] -> CO2[c] + SUCCSAL[c]
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB

Top 10 Homologs in PDB (as of Nov 2020):

PDB	aa ident	species	PDB title
2XT6	87%	MYCOBACTERIUM SMEGMATIS	Crystal structure of Mycobacterium smegmatis alpha-ketoglutarate decarboxylase homodimer (orthorhombic form)
6R2D	86%	Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)	Crystal structure of the SucA domain of Mycobacterium smegmatis KGD after soaking with succinylphosphonate phosphonoethyl ester, followed by temperature increase
6R2C	86%	Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)	Crystal structure of the SucA domain of Mycobacterium smegmatis KGD after soaking with succinylphosphonate phosphonoethyl ester (PESP)
6R2B	86%	Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)	Crystal structure of the SucA domain of Mycobacterium smegmatis KGD after soaking with succinylphosphonate
6R2A	86%	Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)	Crystal structure of the SucA domain of Mycobacterium smegmatis KGD cocrystallized with succinylphosphonate phosphonoethyl ester (PESP)
6R29	86%	Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)	Crystal structure of the SucA domain of Mycobacterium smegmatis KGD cocrystallized with succinylphosphonate
6I2Q	86%	Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)	Crystal structure of the wild-type SucA domain of Mycobacterium smegmatis KGD (alpha-ketoglutarate decarboxylase), in complex with GarA
3ZHV	86%	MYCOBACTERIUM SMEGMATIS	Crystal structure of the SucA domain of Mycobacterium smegmatis KGD, post-decarboxylation intermediate from pyruvate (2-hydroxyethyl-ThDP)
3ZHU	86%	MYCOBACTERIUM SMEGMATIS	Crystal structure of the SucA domain of Mycobacterium smegmatis KGD, second post-decarboxylation intermediate from 2-oxoadipate
3ZHT	86%	MYCOBACTERIUM SMEGMATIS	Crystal structure of the SucA domain of Mycobacterium smegmatis KGD, first post-decarboxylation intermediate from 2-oxoadipate

Links to additional information on Rv1248c:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = -1.996 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- BioCyc
- Systems Biology
- Mycobrowser
- PATRIC

Amino Acid Sequence

VANISSPFGQNEWLVEEMYRKFRDDPSSVDPSWHEFLVDYSPEPTSQPAAEPTRVTSPLVAERAAAAAPQAPPKPADTAAAGNGVVAALAAKTAVPPPAE
GDEVAVLRGAAAAVVKNMSASLEVPTATSVRAVPAKLLIDNRIVINNQLKRTRGGKISFTHLLGYALVQAVKKFPNMNRHYTEVDGKPTAVTPAHTNLGL
AIDLQGKDGKRSLVVAGIKRCETMRFAQFVTAYEDIVRRARDGKLTTEDFAGVTISLTNPGTIGTVHSVPRLMPGQGAIIGVGAMEYPAEFQGASEERIA
ELGIGKLITLTSTYDHRIIQGAESGDFLRTIHELLLSDGFWDEVFRELSIPYLPVRWSTDNPDSIVDKNARVMNLIAAYRNRGHLMADTDPLRLDKARFR
SHPDLEVLTHGLTLWDLDRVFKVDGFAGAQYKKLRDVLGLLRDAYCRHIGVEYAHILDPEQKEWLEQRVETKHVKPTVAQQKYILSKLNAAEAFETFLQT
KYVGQKRFSLEGAESVIPMMDAAIDQCAEHGLDEVVIGMPHRGRLNVLANIVGKPYSQIFTEFEGNLNPSQAHGSGDVKYHLGATGLYLQMFGDNDIQVS
LTANPSHLEAVDPVLEGLVRAKQDLLDHGSIDSDGQRAFSVVPLMLHGDAAFAGQGVVAETLNLANLPGYRVGGTIHIIVNNQIGFTTAPEYSRSSEYCT
DVAKMIGAPIFHVNGDDPEACVWVARLAVDFRQRFKKDVVIDMLCYRRRGHNEGDDPSMTNPYVYDVVDTKRGARKSYTEALIGRGDISMKEAEDALRDY
QGQLERVFNEVRELEKHGVQPSESVESDQMIPAGLATAVDKSLLARIGDAFLALPNGFTAHPRVQPVLEKRREMAYEGKIDWAFGELLALGSLVAEGKLV
RLSGQDSRRGTFSQRHSVLIDRHTGEEFTPLQLLATNSDGSPTGGKFLVYDSPLSEYAAVGFEYGYTVGNPDAVVLWEAQFGDFVNGAQSIIDEFISSGE
AKWGQLSNVVLLLPHGHEGQGPDHTSARIERFLQLWAEGSMTIAMPSTPSNYFHLLRRHALDGIQRPLIVFTPKSMLRHKAAVSEIKDFTEIKFRSVLEE
PTYEDGIGDRNKVSRILLTSGKLYYELAARKAKDNRNDLAIVRLEQLAPLPRRRLRETLDRYENVKEFFWVQEEPANQGAWPRFGLELPELLPDKLAGIK
RISRRAMSAPSSGSSKVHAVEQQEILDEAFG

(Nucleotide sequence available on KEGG)

Additional Information

KGD (E2 subunit of alpha-ketoglutarate dehydrogenase)
also: HOAS, 2-hydroxy-3-oxoadipate synthase
de Carvalho et al (2010. Chem Biol. http://www.ncbi.nlm.nih.gov/pubmed/20416504
Maksymiuk et al (2015). Tuberculosis. http://www.ncbi.nlm.nih.gov/pubmed/26547230

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 1.000000; 46 non-insertions in a row out of 46 sites
Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 1.000000; 46 non-insertions in a row out of 46 sites
Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 1.000000; 46 non-insertions in a row out of 46 sites
Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 1.000000; 46 non-insertions in a row out of 46 sites
Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 1.000000; 46 non-insertions in a row out of 46 sites
Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 0.05
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

RNA processing and modification

Energy production and conversion

Chromatin structure and dynamics

Amino acid transport and metabolism

Cell cycle control, cell division, chromosome partitioning

Carbohydrate transport and metabolism

Nucleotide transport and metabolism

Lipid transport and metabolism

Coenzyme transport and metabolism

Transcription

Translation, ribosomal structure and biogenesis

Cell wall/membrane/envelope biogenesis

Replication, recombination and repair

Posttranslational modification, protein turnover, chaperones

Cell motility

Secondary metabolites biosynthesis, transport and catabolism

Inorganic ion transport and metabolism

Function unknown

General function prediction only

Intracellular trafficking, secretion, and vesicular transport

Signal transduction mechanisms

Extracellular structures

Defense mechanisms

Nuclear structure

Cytoskeleton

BioCyc Co-regulated genes based on gene expression profiling (Systems Biology, Inferelator Network)

Differentially expressed as result of RNASeq in glycerol environment (Only top 20 genes shown sorted by log fold change with p_adj 0.05).

Conditionally essential as result of TNSeq (Only top 20 genes shown sorted by log fold change with p_adj 0.05).

BioCyc Transcription factor binding based on ChIP-Seq (Systems Biology)

Binds To:
- No bindings to other targets were found.
Bound By:
- No bindings from other targets were found.

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0047c (-) (Direct binding)
- Rv0081 (-) (Direct binding)
- Rv3488 (-) (Direct binding)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Not upregulated by other genes.
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Not downregulated by other genes.

TBCAP

Tubculosis Community Annotation Project (

Slayden et al., 2013

Rv1248c (-)

Property	Value	Creator	Evidence	PMID	Comment
Term	EC:4.1.1.71 2-oxoglutarate decarboxylase. - IPI	njamshidi	IPI	16045627	contrary to initial sequence based annotation, the sucA gene does not code for E1 subunit of PDH, rather it codes for akg dearboxylase see PMID: 16045627 and 16027371 J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Term	TBRXN:OXGDC 2-oxoglutarate decarboxylase - IPI	njamshidi	IPI	16045627	contrary to initial sequence based annotation, the sucA gene does not code for E1 subunit of PDH, rather it codes for akg dearboxylase see PMID: 16045627 and 16027371 J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Citation	Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. J. Tian, R. Bryk et al. Proc. Natl. Acad. Sci. U.S.A. 2005	njamshidi	IPI	16027371\|16045627	contrary to initial sequence based annotation, the sucA gene does not code for E1 subunit of PDH, rather it codes for akg dearboxylase see PMID: 16045627 and 16027371
Term	EC:4.1.1.71 2-oxoglutarate decarboxylase. - IPI	njamshidi	IPI	16045627	contrary to initial sequence based annotation, the sucA gene does not code for E1 subunit of PDH, rather it codes for akg dearboxylase see PMID: 16045627 and 16027371 J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005
Term	TBRXN:OXGDC 2-oxoglutarate decarboxylase - IPI	njamshidi	IPI	16045627	contrary to initial sequence based annotation, the sucA gene does not code for E1 subunit of PDH, rather it codes for akg dearboxylase see PMID: 16045627 and 16027371 J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005
Term	TBRXN:OXGDC 2-oxoglutarate decarboxylase - IDA	njamshidi	IDA	16045627	contrary to initial sequence based annotation, the sucA gene does not code for E1 subunit of PDH, rather it codes for akg dearboxylase see PMID: 16045627 and 16027371 J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Citation	Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. J. Tian, R. Bryk et al. Proc. Natl. Acad. Sci. U.S.A. 2005	njamshidi	IDA	16027371\|16045627	contrary to initial sequence based annotation, the sucA gene does not code for E1 subunit of PDH, rather it codes for akg dearboxylase see PMID: 16045627 and 16027371
Term	EC:4.1.1.71 2-oxoglutarate decarboxylase. - IDA	njamshidi	IDA	16045627	contrary to initial sequence based annotation, the sucA gene does not code for E1 subunit of PDH, rather it codes for akg dearboxylase see PMID: 16045627 and 16027371 J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005
Term	TBRXN:OXGDC 2-oxoglutarate decarboxylase - IDA	njamshidi	IDA	16045627	contrary to initial sequence based annotation, the sucA gene does not code for E1 subunit of PDH, rather it codes for akg dearboxylase see PMID: 16045627 and 16027371 J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005
Citation	Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. J. Tian, R. Bryk et al. Mol. Microbiol. 2005	njamshidi	ISS	16045627	contrary to initial sequence based annotation, the sucA gene does not code for E1 subunit of PDH, rather it codes for akg dearboxylase see PMID: 16045627 and 16027371
Term	EC:4.1.1.71 2-oxoglutarate decarboxylase. - ISS	njamshidi	ISS	16045627	contrary to initial sequence based annotation, the sucA gene does not code for E1 subunit of PDH, rather it codes for akg dearboxylase see PMID: 16045627 and 16027371 J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Term	TBRXN:OXGDC 2-oxoglutarate decarboxylase - ISS	njamshidi	ISS	16045627	contrary to initial sequence based annotation, the sucA gene does not code for E1 subunit of PDH, rather it codes for akg dearboxylase see PMID: 16045627 and 16027371 J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Citation	Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. J. Tian, R. Bryk et al. Proc. Natl. Acad. Sci. U.S.A. 2005	njamshidi	ISS	16027371\|16045627	contrary to initial sequence based annotation, the sucA gene does not code for E1 subunit of PDH, rather it codes for akg dearboxylase see PMID: 16045627 and 16027371
Term	EC:4.1.1.71 2-oxoglutarate decarboxylase. - ISS	njamshidi	ISS	16045627	contrary to initial sequence based annotation, the sucA gene does not code for E1 subunit of PDH, rather it codes for akg dearboxylase see PMID: 16045627 and 16027371 J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005
Term	TBRXN:OXGDC 2-oxoglutarate decarboxylase - ISS	njamshidi	ISS	16045627	contrary to initial sequence based annotation, the sucA gene does not code for E1 subunit of PDH, rather it codes for akg dearboxylase see PMID: 16045627 and 16027371 J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005
Citation	Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. J. Tian, R. Bryk et al. Mol. Microbiol. 2005	njamshidi	IPI	16045627	contrary to initial sequence based annotation, the sucA gene does not code for E1 subunit of PDH, rather it codes for akg dearboxylase see PMID: 16045627 and 16027371
Citation	Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. J. Tian, R. Bryk et al. Mol. Microbiol. 2005	njamshidi	IDA	16045627	contrary to initial sequence based annotation, the sucA gene does not code for E1 subunit of PDH, rather it codes for akg dearboxylase see PMID: 16045627 and 16027371
Term	EC:4.1.1.71 2-oxoglutarate decarboxylase. - IDA	njamshidi	IDA	16045627	contrary to initial sequence based annotation, the sucA gene does not code for E1 subunit of PDH, rather it codes for akg dearboxylase see PMID: 16045627 and 16027371 J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Interaction	RegulatedBy Rv3676	yamir.moreno	ISO		E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv3676	yamir.moreno	ISO		E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Citation	Central carbon metabolism in Mycobacterium tuberculosis: an unexpected frontier. authors,KY. Rhee,LP. de Carvalho,R. Bryk,S. Ehrt,J. Marrero,SW. Park,D. Schnappinger,A. Venugopal,C. Nathan Trends Microbiol. 2011	extern:JZUCKER		21561773	Traceable author statement to experimental support
Term	EC:4.1.1.71 2-oxoglutarate decarboxylase. - NR	extern:JZUCKER	NR		Traceable author statement to experimental support authors,KY. Rhee,LP. de Carvalho,R. Bryk,S. Ehrt,J. Marrero,SW. Park,D. Schnappinger,A. Venugopal,C. Nathan Central carbon metabolism in Mycobacterium tuberculosis: an unexpected frontier. Trends Microbiol. 2011
Term	EC:1.2.4.2 Oxoglutarate dehydrogenase (succinyl-transferring). - NR	extern:JZUCKER	NR		Traceable author statement to experimental support authors,KY. Rhee,LP. de Carvalho,R. Bryk,S. Ehrt,J. Marrero,SW. Park,D. Schnappinger,A. Venugopal,C. Nathan Central carbon metabolism in Mycobacterium tuberculosis: an unexpected frontier. Trends Microbiol. 2011
Term	EC:2.2.1.5 2-hydroxy-3-oxoadipate synthase. - NR	extern:JZUCKER	NR		Traceable author statement to experimental support authors,KY. Rhee,LP. de Carvalho,R. Bryk,S. Ehrt,J. Marrero,SW. Park,D. Schnappinger,A. Venugopal,C. Nathan Central carbon metabolism in Mycobacterium tuberculosis: an unexpected frontier. Trends Microbiol. 2011
Citation	Activity-based metabolomic profiling of enzymatic function: identification of Rv1248c as a mycobacterial 2-hydroxy-3-oxoadipate synthase. LP. de Carvalho, H. Zhao et al. Chem. Biol. 2010	extern:JZUCKER		20416504	Assay of unpurified protein expressed in a heterlogous host
Term	EC:4.1.1.71 2-oxoglutarate decarboxylase. - NR	extern:JZUCKER	NR		Assay of unpurified protein expressed in a heterlogous host LP. de Carvalho, H. Zhao et al. Activity-based metabolomic profiling of enzymatic function: identification of Rv1248c as a mycobacterial 2-hydroxy-3-oxoadipate synthase. Chem. Biol. 2010
Term	EC:1.2.4.2 Oxoglutarate dehydrogenase (succinyl-transferring). - NR	extern:JZUCKER	NR		Assay of unpurified protein expressed in a heterlogous host LP. de Carvalho, H. Zhao et al. Activity-based metabolomic profiling of enzymatic function: identification of Rv1248c as a mycobacterial 2-hydroxy-3-oxoadipate synthase. Chem. Biol. 2010
Term	EC:2.2.1.5 2-hydroxy-3-oxoadipate synthase. - NR	extern:JZUCKER	NR		Assay of unpurified protein expressed in a heterlogous host LP. de Carvalho, H. Zhao et al. Activity-based metabolomic profiling of enzymatic function: identification of Rv1248c as a mycobacterial 2-hydroxy-3-oxoadipate synthase. Chem. Biol. 2010

Property

Value

Creator

Evidence

PMID

Comment

Term

EC:4.1.1.71 2-oxoglutarate decarboxylase. - IPI

njamshidi

IPI

16045627

contrary to initial sequence based annotation, the sucA gene does not code for E1 subunit of PDH, rather it codes for akg dearboxylase see PMID: 16045627 and 16027371
J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005

Term

TBRXN:OXGDC 2-oxoglutarate decarboxylase - IPI

njamshidi

IPI

16045627

Citation

Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. J. Tian, R. Bryk et al. Proc. Natl. Acad. Sci. U.S.A. 2005

njamshidi

IPI

16027371|16045627

contrary to initial sequence based annotation, the sucA gene does not code for E1 subunit of PDH, rather it codes for akg dearboxylase see PMID: 16045627 and 16027371

Term

EC:4.1.1.71 2-oxoglutarate decarboxylase. - IPI

njamshidi

IPI

16045627

contrary to initial sequence based annotation, the sucA gene does not code for E1 subunit of PDH, rather it codes for akg dearboxylase see PMID: 16045627 and 16027371
J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005

Term

TBRXN:OXGDC 2-oxoglutarate decarboxylase - IPI

njamshidi

IPI

16045627

contrary to initial sequence based annotation, the sucA gene does not code for E1 subunit of PDH, rather it codes for akg dearboxylase see PMID: 16045627 and 16027371
J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005

Term

TBRXN:OXGDC 2-oxoglutarate decarboxylase - IDA

njamshidi

IDA

16045627

Citation

Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. J. Tian, R. Bryk et al. Proc. Natl. Acad. Sci. U.S.A. 2005

njamshidi

IDA

16027371|16045627

contrary to initial sequence based annotation, the sucA gene does not code for E1 subunit of PDH, rather it codes for akg dearboxylase see PMID: 16045627 and 16027371

Term

EC:4.1.1.71 2-oxoglutarate decarboxylase. - IDA

njamshidi

IDA

16045627

contrary to initial sequence based annotation, the sucA gene does not code for E1 subunit of PDH, rather it codes for akg dearboxylase see PMID: 16045627 and 16027371
J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005

Term

TBRXN:OXGDC 2-oxoglutarate decarboxylase - IDA

njamshidi

IDA

16045627

contrary to initial sequence based annotation, the sucA gene does not code for E1 subunit of PDH, rather it codes for akg dearboxylase see PMID: 16045627 and 16027371
J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005

Citation

Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. J. Tian, R. Bryk et al. Mol. Microbiol. 2005

njamshidi

ISS

16045627

contrary to initial sequence based annotation, the sucA gene does not code for E1 subunit of PDH, rather it codes for akg dearboxylase see PMID: 16045627 and 16027371

Term

EC:4.1.1.71 2-oxoglutarate decarboxylase. - ISS

njamshidi

ISS

16045627

Term

TBRXN:OXGDC 2-oxoglutarate decarboxylase - ISS

njamshidi

ISS

16045627

Citation

Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. J. Tian, R. Bryk et al. Proc. Natl. Acad. Sci. U.S.A. 2005

njamshidi

ISS

16027371|16045627

contrary to initial sequence based annotation, the sucA gene does not code for E1 subunit of PDH, rather it codes for akg dearboxylase see PMID: 16045627 and 16027371

Term

EC:4.1.1.71 2-oxoglutarate decarboxylase. - ISS

njamshidi

ISS

16045627

contrary to initial sequence based annotation, the sucA gene does not code for E1 subunit of PDH, rather it codes for akg dearboxylase see PMID: 16045627 and 16027371
J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005

Term

TBRXN:OXGDC 2-oxoglutarate decarboxylase - ISS

njamshidi

ISS

16045627

contrary to initial sequence based annotation, the sucA gene does not code for E1 subunit of PDH, rather it codes for akg dearboxylase see PMID: 16045627 and 16027371
J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005

Citation

Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. J. Tian, R. Bryk et al. Mol. Microbiol. 2005

njamshidi

IPI

16045627

contrary to initial sequence based annotation, the sucA gene does not code for E1 subunit of PDH, rather it codes for akg dearboxylase see PMID: 16045627 and 16027371

Citation

Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. J. Tian, R. Bryk et al. Mol. Microbiol. 2005

njamshidi

IDA

16045627

contrary to initial sequence based annotation, the sucA gene does not code for E1 subunit of PDH, rather it codes for akg dearboxylase see PMID: 16045627 and 16027371

Term

EC:4.1.1.71 2-oxoglutarate decarboxylase. - IDA

njamshidi

IDA

16045627

Interaction

RegulatedBy Rv3676

yamir.moreno

ISO

E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008

Interaction

RegulatedBy Rv3676

yamir.moreno

ISO

E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006

Citation

Central carbon metabolism in Mycobacterium tuberculosis: an unexpected frontier. authors,KY. Rhee,LP. de Carvalho,R. Bryk,S. Ehrt,J. Marrero,SW. Park,D. Schnappinger,A. Venugopal,C. Nathan Trends Microbiol. 2011

extern:JZUCKER

21561773

Traceable author statement to experimental support

Term

EC:4.1.1.71 2-oxoglutarate decarboxylase. - NR

extern:JZUCKER

Traceable author statement to experimental support
authors,KY. Rhee,LP. de Carvalho,R. Bryk,S. Ehrt,J. Marrero,SW. Park,D. Schnappinger,A. Venugopal,C. Nathan Central carbon metabolism in Mycobacterium tuberculosis: an unexpected frontier. Trends Microbiol. 2011

Term

EC:1.2.4.2 Oxoglutarate dehydrogenase (succinyl-transferring). - NR

extern:JZUCKER

Term

EC:2.2.1.5 2-hydroxy-3-oxoadipate synthase. - NR

extern:JZUCKER

Citation

Activity-based metabolomic profiling of enzymatic function: identification of Rv1248c as a mycobacterial 2-hydroxy-3-oxoadipate synthase. LP. de Carvalho, H. Zhao et al. Chem. Biol. 2010

extern:JZUCKER

20416504

Assay of unpurified protein expressed in a heterlogous host

Term

EC:4.1.1.71 2-oxoglutarate decarboxylase. - NR

extern:JZUCKER

Assay of unpurified protein expressed in a heterlogous host
LP. de Carvalho, H. Zhao et al. Activity-based metabolomic profiling of enzymatic function: identification of Rv1248c as a mycobacterial 2-hydroxy-3-oxoadipate synthase. Chem. Biol. 2010

Term

EC:1.2.4.2 Oxoglutarate dehydrogenase (succinyl-transferring). - NR

extern:JZUCKER

Term

EC:2.2.1.5 2-hydroxy-3-oxoadipate synthase. - NR

extern:JZUCKER

Comments