TB Genome Annotation Portal

Rv1246c (relE)

Amino Acid Sequence

VSDDHPYHVAITATAARDLQRLPEKIAAACVEFVFGPLLNNPHRLGKPLRNDLEGLHSARRGDYRVVYAIDDGHHRVEIIHIARRSASYRMNPCRPR
(Nucleotide sequence available on KEGG)

Additional Information

relE1
http://www.ncbi.nlm.nih.gov/pubmed/20061486

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Non-Essential Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
3 non-insertions in a row out of 7 sites
Non-Essential Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 7 sites
Non-Essential Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 7 sites
Non-Essential minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 8 sites
Non-Essential minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 8 sites
Non-Essential 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Non-Essential C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: 1.4
Non-Essential 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).
TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.
Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

    • Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)

    • Upregulates:

      • Does not upregulate other genes.

    • Upregulated by:

      • Not upregulated by other genes.

    • Downregulates:

      • Does not downregulate other genes.

    • Downregulated by:



    TBCAP

    Tubculosis Community Annotation Project (    Slayden et al., 2013)

    Rv1246c (relE)

    PropertyValueCreatorEvidencePMIDComment
    InteractionRegulatory Rv2052cshahanup86TASCo-expression (Functional linkage)
    authors,R. Singh,CE. Barry,HI. Boshoff The three RelE homologs of Mycobacterium tuberculosis have individual, drug-specific effects on bacterial antibiotic tolerance. J. Bacteriol. 2010
    InteractionRegulatory Rv2053cshahanup86TASCo-expression (Functional linkage)
    authors,R. Singh,CE. Barry,HI. Boshoff The three RelE homologs of Mycobacterium tuberculosis have individual, drug-specific effects on bacterial antibiotic tolerance. J. Bacteriol. 2010
    Citation[Protein-protein interaction between hypothetical protein Rv1246c and Rv1247c of Mycobacterium tuberculosis] ZL. Shang, L. Bao et al. Sichuan Da Xue Xue Bao Yi Xue Ban 2007aparna.vchalamIPI17441326Affinity purification (Physical interaction)
    InteractionInhibitedBy Rv1247caparna.vchalamIPIAffinity purification (Physical interaction)
    ZL. Shang, L. Bao et al. [Protein-protein interaction between hypothetical protein Rv1246c and Rv1247c of Mycobacterium tuberculosis] Sichuan Da Xue Xue Bao Yi Xue Ban 2007
    CitationThree Mycobacterium tuberculosis Rel toxin:antitoxin modules inhibit mycobacterial growth and are expressed in human-infected macrophages. SB. Korch, H. Contreras et al. J. Bacteriol. 2008aparna.vchalamIPI19114484Affinity purification (Physical interaction)
    InteractionInhibitedBy Rv1247caparna.vchalamIPIAffinity purification (Physical interaction)
    SB. Korch, H. Contreras et al. Three Mycobacterium tuberculosis Rel toxin:antitoxin modules inhibit mycobacterial growth and are expressed in human-infected macrophages. J. Bacteriol. 2008
    InteractionInhibitedBy Rv1247caparna.vchalamIPIAffinity purification (Physical interaction)
    ZL. Shang, L. Bao et al. [Protein-protein interaction between hypothetical protein Rv1246c and Rv1247c of Mycobacterium tuberculosis] Sichuan Da Xue Xue Bao Yi Xue Ban 2007
    InteractionInhibitedBy Rv1247caparna.vchalamIPIAffinity purification (Physical interaction)
    SB. Korch, H. Contreras et al. Three Mycobacterium tuberculosis Rel toxin:antitoxin modules inhibit mycobacterial growth and are expressed in human-infected macrophages. J. Bacteriol. 2008
    CitationComprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. authors,HR. Ramage,LE. Connolly,JS. Cox PLoS Genet. 2009jlew20011113RelE homolog, Toxic when expressed in Msmeg, rescued by antitoxin (Rv1247c)
    SymbolrelEjlewEach pair shows interaction by two-hybrid and GST pulldown. F and B each interact with E, G, K, and itself.
    authors,M. Yang,C. Gao,Y. Wang,H. Zhang,ZG. He Characterization of the interaction and cross-regulation of three Mycobacterium tuberculosis RelBE modules. PLoS ONE 2010
    CitationCharacterization of the interaction and cross-regulation of three Mycobacterium tuberculosis RelBE modules. authors,M. Yang,C. Gao,Y. Wang,H. Zhang,ZG. He PLoS ONE 2010jlew20498855Each pair shows interaction by two-hybrid and GST pulldown. F and B each interact with E, G, K, and itself.
    SymbolrelE1jlewEach toxin individually arrests growth of both M. tuberculosis and E. coli, an effect that is neutralized by coexpression of the cognate antitoxin.
    authors,R. Singh,CE. Barry,HI. Boshoff The three RelE homologs of Mycobacterium tuberculosis have individual, drug-specific effects on bacterial antibiotic tolerance. J. Bacteriol. 2010
    CitationThe three RelE homologs of Mycobacterium tuberculosis have individual, drug-specific effects on bacterial antibiotic tolerance. authors,R. Singh,CE. Barry,HI. Boshoff J. Bacteriol. 2010jlew20061486Each toxin individually arrests growth of both M. tuberculosis and E. coli, an effect that is neutralized by coexpression of the cognate antitoxin.
    SymbolrelEjlewrelB and relE interact directly. Overexpression of Mtb relE, relG and relK induces growth arrest in Msmeg; reversed by expression of relB, relF and relJ
    SB. Korch, H. Contreras et al. Three Mycobacterium tuberculosis Rel toxin:antitoxin modules inhibit mycobacterial growth and are expressed in human-infected macrophages. J. Bacteriol. 2008
    CitationThree Mycobacterium tuberculosis Rel toxin:antitoxin modules inhibit mycobacterial growth and are expressed in human-infected macrophages. SB. Korch, H. Contreras et al. J. Bacteriol. 2008jlew19114484relB and relE interact directly. Overexpression of Mtb relE, relG and relK induces growth arrest in Msmeg; reversed by expression of relB, relF and relJ
    SymbolRelE1jlewWe report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin.
    authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
    CitationKilling activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. authors,A. Gupta FEMS Microbiol. Lett. 2009jlew19016878We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin.
    Otherstart:1388685rslaydenConserved hypothetical protein, highly similar to Rv2866
    Otherstop:1388978rslaydenConserved hypothetical protein, highly similar to Rv2866
    Otherstrand:+rslaydenConserved hypothetical protein, highly similar to Rv2866
    Otherstart:1388685rslaydenMTV003.12 hypothetical Mycobacterium tuberculosis protein (87 aa), FASTA scores: opt: 290, E(): 3.9e-24, (54.1% identity in 85 aa overlap)
    Otherstop:1388978rslaydenMTV003.12 hypothetical Mycobacterium tuberculosis protein (87 aa), FASTA scores: opt: 290, E(): 3.9e-24, (54.1% identity in 85 aa overlap)
    Otherstrand:+rslaydenMTV003.12 hypothetical Mycobacterium tuberculosis protein (87 aa), FASTA scores: opt: 290, E(): 3.9e-24, (54.1% identity in 85 aa overlap)

    Comments