Rv1224 (tatB)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: twin arginine-targeting protein translocase TatB
- REFSEQ: sec-independent translocase
- PATRIC: Twin-arginine translocation protein TatB
- TUBERCULIST: Probable protein TatB
- NCBI: Probable protein TatB
- updated information (H37Rv4):
  - gene name: tatB
  - function:
  - reference:
Type: Not Target
Start: 1367463
End: 1367858
Operon:

Trans-membrane region:
Role: V - Conserved hypotheticals
GO terms:
- GO:0043953 - protein transport by the Tat complex (Uniprot)
- GO:0040007 - growth (Uniprot)
- GO:0016021 - integral component of membrane (Uniprot)
- GO:0016020 - membrane (Uniprot)
- GO:0015031 - protein transport (Uniprot)
- GO:0009306 - protein secretion (Uniprot)
- GO:0008565 - protein transporter activity (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
Links to additional information on tatB:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = -9.107 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- BioCyc
- Systems Biology
- Mycobrowser
- PATRIC

Amino Acid Sequence

VFANIGWWEMLVLVMVGLVVLGPERLPGAIRWAASALRQARDYLSGVTSQLREDIGPEFDDLRGHLGELQKLRGMTPRAALTKHLLDGDDSLFTGDFDRP
TPKKPDAAGSAGPDATEQIGAGPIPFDSDAT

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Uncertain	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.984650; 5 non-insertions in a row out of 5 sites
Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.992850; 5 non-insertions in a row out of 5 sites
Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.994650; 5 non-insertions in a row out of 5 sites
Uncertain	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.456650; 5 non-insertions in a row out of 6 sites
Uncertain	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.452600; 5 non-insertions in a row out of 6 sites
Non-Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Non-Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 0.65
Growth-Defect	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

RNA processing and modification

Energy production and conversion

Chromatin structure and dynamics

Amino acid transport and metabolism

Cell cycle control, cell division, chromosome partitioning

Carbohydrate transport and metabolism

Nucleotide transport and metabolism

Lipid transport and metabolism

Coenzyme transport and metabolism

Transcription

Translation, ribosomal structure and biogenesis

Cell wall/membrane/envelope biogenesis

Replication, recombination and repair

Posttranslational modification, protein turnover, chaperones

Cell motility

Secondary metabolites biosynthesis, transport and catabolism

Inorganic ion transport and metabolism

Function unknown

General function prediction only

Intracellular trafficking, secretion, and vesicular transport

Signal transduction mechanisms

Extracellular structures

Defense mechanisms

Nuclear structure

Cytoskeleton

BioCyc Co-regulated genes based on gene expression profiling (Systems Biology, Inferelator Network)

Differentially expressed as result of RNASeq in glycerol environment (Only top 20 genes shown sorted by log fold change with p_adj 0.05).

Conditionally essential as result of TNSeq (Only top 20 genes shown sorted by log fold change with p_adj 0.05).

BioCyc Transcription factor binding based on ChIP-Seq (Systems Biology)

Binds To:
- No bindings to other targets were found.
Bound By:
- No bindings from other targets were found.

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0691c (-) (Direct binding)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Not upregulated by other genes.
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Not downregulated by other genes.

Property	Value	Creator	Evidence	PMID	Comment
Interaction	Operon Rv2093c	gaat3s	NAS		Gene Neighbourhood(Functional Linkage) JA. McDonough, KE. Hacker et al. The twin-arginine translocation pathway of Mycobacterium smegmatis is functional and required for the export of mycobacterial beta-lactamases. J. Bacteriol. 2005
Interaction	PhysicalInteraction Rv2068c	gaat3s	IDA		Spectrophotometric Analysis JA. McDonough, KE. Hacker et al. The twin-arginine translocation pathway of Mycobacterium smegmatis is functional and required for the export of mycobacterial beta-lactamases. J. Bacteriol. 2005
Citation	Characterization of the twin-arginine translocase secretion system of Mycobacterium smegmatis. JE. Posey, TM. Shinnick et al. J. Bacteriol. 2006	gaat3s	NAS	16452415	Gene Neighbourhood(Functional Linkage)
Interaction	Operon Rv2094c	gaat3s	NAS		Gene Neighbourhood(Functional Linkage) JE. Posey, TM. Shinnick et al. Characterization of the twin-arginine translocase secretion system of Mycobacterium smegmatis. J. Bacteriol. 2006
Interaction	Operon Rv2093c	gaat3s	NAS		Gene Neighbourhood(Functional Linkage) JE. Posey, TM. Shinnick et al. Characterization of the twin-arginine translocase secretion system of Mycobacterium smegmatis. J. Bacteriol. 2006
Citation	The Tat protein export pathway. authors,BC. Berks,F. Sargent,T. Palmer Mol. Microbiol. 2000	gaat3s	NAS	10652088	Gene Neighbourhood(Functional Linkage)
Interaction	Operon Rv2094c	gaat3s	NAS		Gene Neighbourhood(Functional Linkage) authors,BC. Berks,F. Sargent,T. Palmer The Tat protein export pathway. Mol. Microbiol. 2000
Interaction	Operon Rv2093c	gaat3s	NAS		Gene Neighbourhood(Functional Linkage) authors,BC. Berks,F. Sargent,T. Palmer The Tat protein export pathway. Mol. Microbiol. 2000
Citation	The twin-arginine translocation pathway of Mycobacterium smegmatis is functional and required for the export of mycobacterial beta-lactamases. JA. McDonough, KE. Hacker et al. J. Bacteriol. 2005	gaat3s	NAS	16267291	Gene Neighbourhood(Functional Linkage)
Interaction	Operon Rv2094c	gaat3s	NAS		Gene Neighbourhood(Functional Linkage) JA. McDonough, KE. Hacker et al. The twin-arginine translocation pathway of Mycobacterium smegmatis is functional and required for the export of mycobacterial beta-lactamases. J. Bacteriol. 2005
Citation	Characterization of the twin-arginine translocase secretion system of Mycobacterium smegmatis. JE. Posey, TM. Shinnick et al. J. Bacteriol. 2006	gaat3s	IDA	16452415	Spectrophotometric Analysis
Interaction	PhysicalInteraction Rv2068c	gaat3s	IDA		Spectrophotometric Analysis JE. Posey, TM. Shinnick et al. Characterization of the twin-arginine translocase secretion system of Mycobacterium smegmatis. J. Bacteriol. 2006
Citation	The Tat protein export pathway. authors,BC. Berks,F. Sargent,T. Palmer Mol. Microbiol. 2000	gaat3s	IDA	10652088	Spectrophotometric Analysis
Interaction	PhysicalInteraction Rv2068c	gaat3s	IDA		Spectrophotometric Analysis authors,BC. Berks,F. Sargent,T. Palmer The Tat protein export pathway. Mol. Microbiol. 2000
Citation	The twin-arginine translocation pathway of Mycobacterium smegmatis is functional and required for the export of mycobacterial beta-lactamases. JA. McDonough, KE. Hacker et al. J. Bacteriol. 2005	gaat3s	IDA	16267291	Spectrophotometric Analysis
Citation	Inactivation of Rv2525c, a substrate of the twin arginine translocation (Tat) system of Mycobacterium tuberculosis, increases beta-lactam susceptibility and virulence. B. Saint-Joanis, C. Demangel et al. J. Bacteriol. 2006	jlew		16952959	essential in Mtb. Saint-Joanis B, Demangel C, Jackson M, Brodin P, Marsollier L, Boshoff H, Cole ST.

TB Genome Annotation Portal