TB Genome Annotation Portal

Rv1208 (gpgS)

Amino Acid Sequence

MTASELVAGDLAGGRAPGALPLDTTWHRPGWTIGELEAAKAGRTISVVLPALNEEATIESVIDSISPLVDGLVDELIVLDSGSTDDTEIRAIASGARVVS
REQALPEVPVRPGKGEALWRSLAATSGDIVVFIDSDLINPHPLFVPWLVGPLLTGEGIQLVKSFYRRPLQVSDVTSGVCATGGGRVTELVARPLLAALRP
ELGCVLQPLSGEYAASRELLTSLPFAPGYGVEIGLLIDTFDRLGLDAIAQVNLGVRAHRNRPLDELGAMSRQVIATLLSRCGIPDSGVGLTQFLPGGPDD
SDYTRHTWPVSLVDRPPMKVMRPR
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv1208/gpgS, gene len: 974 bp, num TA sites: 14
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBioessential7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Microessential 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASno data BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathessentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathessentialM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=0.0)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifeessential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifeessentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=0.0)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysnon-essentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysgrowth defectYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysYES (LFC=-4.55)YM rich vs minimal mediumresampling

Analysis of Positive Selection in Clinical Isolates *new*

Moldova (2,057)global set (5,195)
under significant positive selection?NONO
omega peak height (95%CI lower bound)2.07 (0.29)1.56 (0.54)
codons under selection
omega plotsomega plot across ORF for Moldova isolatesomega plot across ORF for CRyPTIC isolates
genetic variants*linklink
statistics at each codonlinklink
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"



TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

    Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

    Interactions based on TFOE data (Rustad et al. 2014)

    • Upregulates:

      • Does not upregulate other genes.
    • Upregulated by:

      • Not upregulated by other genes.
    • Downregulates:

      • Does not downregulate other genes.
    • Downregulated by:



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv1208 (gpgS)

    PropertyValueCreatorEvidencePMIDComment
    SymbolgpgSmjacksonIDAOther (lipo)polysaccharides [Methylglucose lipolysaccharides, glycogen and capsular alpha-1,4 glucan]
    NameGlucosyl-3-phosphoglycerate synthase involved in methylglucose lipolysaccharide synthesismjacksonIDAOther (lipo)polysaccharides [Methylglucose lipolysaccharides, glycogen and capsular alpha-1,4 glucan]
    SymbolgpgSmjacksonIMPOther (lipo)polysaccharides [Methylglucose lipolysaccharides, glycogen and capsular alpha-1,4 glucan]
    NameGlucosyl-3-phosphoglycerate synthase involved in methylglucose lipolysaccharide synthesismjacksonIMPOther (lipo)polysaccharides [Methylglucose lipolysaccharides, glycogen and capsular alpha-1,4 glucan]
    SymbolgpgSmjacksonGlucosyl-3-phosphoglycerate synthase involved in methylglucose lipolysaccharide synthesis (phenotypic [mycobacterial recombinant strains]; enzymatic)
    N. Empadinhas, L. Albuquerque et al. Identification of the mycobacterial glucosyl-3-phosphoglycerate synthase. FEMS Microbiol. Lett. 2008
    CitationIdentification of the mycobacterial glucosyl-3-phosphoglycerate synthase. N. Empadinhas, L. Albuquerque et al. FEMS Microbiol. Lett. 2008mjackson18221489Glucosyl-3-phosphoglycerate synthase involved in methylglucose lipolysaccharide synthesis (phenotypic [mycobacterial recombinant strains]; enzymatic)
    OtherTBPWY:(MGLP and alpha-1,4 glucans)mjacksonGlucosyl-3-phosphoglycerate synthase involved in methylglucose lipolysaccharide synthesis (phenotypic [mycobacterial recombinant strains]; enzymatic)
    N. Empadinhas, L. Albuquerque et al. Identification of the mycobacterial glucosyl-3-phosphoglycerate synthase. FEMS Microbiol. Lett. 2008
    SymbolgpgSmjacksonGlucosyl-3-phosphoglycerate synthase involved in methylglucose lipolysaccharide synthesis (phenotypic [mycobacterial recombinant strains]; enzymatic)
    D. Kaur, H. Pham et al. Initiation of methylglucose lipopolysaccharide biosynthesis in mycobacteria. PLoS ONE 2009
    CitationInitiation of methylglucose lipopolysaccharide biosynthesis in mycobacteria. D. Kaur, H. Pham et al. PLoS ONE 2009mjackson19421329Glucosyl-3-phosphoglycerate synthase involved in methylglucose lipolysaccharide synthesis (phenotypic [mycobacterial recombinant strains]; enzymatic)
    OtherTBPWY:(MGLP and alpha-1,4 glucans)mjacksonGlucosyl-3-phosphoglycerate synthase involved in methylglucose lipolysaccharide synthesis (phenotypic [mycobacterial recombinant strains]; enzymatic)
    D. Kaur, H. Pham et al. Initiation of methylglucose lipopolysaccharide biosynthesis in mycobacteria. PLoS ONE 2009

    Comments