Rv1183 (mmpL10)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: transmembrane transporter mmpL10
- REFSEQ: transmembrane transport protein MmpL10
- PATRIC: membrane protein MmpL family putative
- TUBERCULIST: Probable conserved transmembrane transport protein MmpL10
- NCBI: Probable conserved transmembrane transport protein MmpL10
- updated information (H37Rv4):
  - gene name: mmpL10
  - function:
  - reference:
Type: Not Target
Start: 1321520
End: 1324528
Operon:

Trans-membrane region:
Role: II.C.4 - Conserved membrane proteins
GO terms:
- GO:0016021 - integral component of membrane (Uniprot)
- GO:0016020 - membrane (Uniprot)
- GO:0006869 - lipid transport (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
- GO:0005829 - cytosol (Uniprot)
- GO:0005618 - cell wall (Uniprot)
- GO:0005576 - extracellular region (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
- 4 NADPH[c] + OCTADECANOYL_COA[c] + 3 RMMALONYLACP[c] -> 4 NADP[c] + 3 CO2[c] + COA[c] + 2 ACP[c] + MYCOLIPDIENOYL_ACP[c]
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
Links to additional information on mmpL10:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 0.809 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

VVGCWVALALVLPMAVPSLAEMAQRHPVAVLPADAPSSVAVRQMAEAFHESGSENILVVLLTDEKGLGAADENVYHTLVDRLRNDAKDVVMLQDFLTTPP
LREVLGSKDGKAWILPIGLAGDLGTPKSYHAYTDVERIVKRTVAGTTLTANVTGPAATVADLTDAGARDRASIELAIAVMLLVILMVIYRNPVTMLLPLV
TIGASLMTAQALVAGVSLVGGLAVSNQAIVLLSAMIAGAGTDYAVFLISRYHEYVRLGEHPERAVQRAMMSVGKVIAASAATVGITFLGMRFAKLGVFST
VGPALAIGIAVSFLAAVTLLPAILVLASPRGWVAPRGERMATFWRRAGTRIVRRPKAYLGASLIGLVALASCASLAHFNYDDRKQLPPSDPSSVGYAAME
HHFSVNQTIPEYLIIHSAHDLRTPRGLADLEQLAQRVSQIPGVAMVRGVTRPNGETLEQARATYQAGQVGNRLGGASRMIDERTGDLNRLASGANLLADN
LGDVRGQVSRAVAGVRSLVDALAYIQNQFGGNKTFNEIDNAARLVSNIHALGDALQVNFDGIANSFDWLDSVVAALDTSPVCDSNPMCGNARVQFHKLQT
ARDNGTLDKVVGLARQLQSTRSPQTVSAVVNDLGRSLNSVVRSLKSLGLDNPDAARARLISMQNGANDLASAGRQVADGVQMLVDQTKNMGIGLNQASAF
LMAMGNDASQPSMAGFNVPPQVLKSEEFKKVAQAFISPDGHTVRYFIQTDLNPFSTAAMDQVNTIIDTAKGAQPNTSLADASISMSGYPVMLRDIRDYYE
RDMRLIVAVTVVVVILILMALLRAIVAPLYLVGSVVISYMSAIGLGVVVFQVFLGQELHWSVPGLAFVVLVAVGADYNMLLASRLRDESALGVRSSVIRT
VRCTGGVITAAGLIFAASMSGLLFSSIGTVVQGGFIIGVGILIDTFVVRTITVPAMATLLGRASWWPGHPWQRCAPEEGQMSARMSARTKTVFQAVADGS
KR

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Non-Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 6 non-insertions in a row out of 52 sites
Non-Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 3 non-insertions in a row out of 52 sites
Non-Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 4 non-insertions in a row out of 52 sites
Non-Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000050; 8 non-insertions in a row out of 53 sites
Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 1.000000; 19 non-insertions in a row out of 53 sites
No-Data	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Too-Short	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: -1
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv1353c (-) (Direct binding)
- Rv3249c (-) (Direct binding)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Rv0023 (-)
- Rv0081 (-)

Property	Value	Creator	Evidence	PMID	Comment
Interaction	RegulatedBy Rv0348	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv0757	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
Interaction	RegulatedBy Rv0757	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
Other	EC:	jjmcfadden			Inferred from direct assay VS. Dubey, TD. Sirakova et al. Disruption of msl3 abolishes the synthesis of mycolipanoic and mycolipenic acids required for polyacyltrehalose synthesis in Mycobacterium tuberculosis H37Rv and causes cell aggregation. Mol. Microbiol. 2002
Citation	Disruption of msl3 abolishes the synthesis of mycolipanoic and mycolipenic acids required for polyacyltrehalose synthesis in Mycobacterium tuberculosis H37Rv and causes cell aggregation. VS. Dubey, TD. Sirakova et al. Mol. Microbiol. 2002	jjmcfadden		12207710	Inferred from direct assay

TB Genome Annotation Portal