TB Genome Annotation Portal

Rv1180 (pks3)

• Current annotations:
  • REFSEQ: polyketide beta-ketoacyl synthase PKS3
  • PATRIC: Polyketide synthase
  • TUBERCULIST: Probable polyketide beta-ketoacyl synthase Pks3
  • NCBI: Probable polyketide beta-ketoacyl synthase Pks3
  • updated information (H37Rv4):
    • gene name: pks3
    • function:
    • reference:
• Type: Not Target
• Start: 1313725
• End: 1315191
• Operon:


• Trans-membrane region:
  
• Role: I.I - Polyketide and non-ribosomal peptide synthesis
• GO terms:
  • GO:1902321 - methyl-branched fatty acid biosynthetic process (Uniprot)
  • GO:0055114 - oxidation-reduction process (Uniprot)
  • GO:0034081 - polyketide synthase complex (Uniprot)
  • GO:0031177 - phosphopantetheine binding (Uniprot)
  • GO:0016746 - transferase activity, transferring acyl groups (Uniprot)
  • GO:0016740 - transferase activity (Uniprot)
  • GO:0016491 - oxidoreductase activity (Uniprot)
  • GO:0016020 - membrane (Uniprot)
  • GO:0008152 - metabolic process (Uniprot)
  • GO:0006633 - fatty acid biosynthetic process (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0003824 - catalytic activity (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • 6 NADPH[c] + OCTADECANOYL_COA[c] + 3 RMMALONYLACP[c] -> 6 NADP[c] + 3 CO2[c] + COA[c] + 2 ACP[c] + MYCOLIPANOIC_ACP[c]
  • 5 NADPH[c] + OCTADECANOYL_COA[c] + 3 RMMALONYLACP[c] -> 5 NADP[c] + 3 CO2[c] + COA[c] + 2 ACP[c] + MYCOLIPENOYL_ACP[c]
  • 4 NADPH[c] + OCTADECANOYL_COA[c] + 3 RMMALONYLACP[c] -> 4 NADP[c] + 3 CO2[c] + COA[c] + 2 ACP[c] + MYCOLIPDIENOYL_ACP[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  5BP1	71%	Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)	Condensing di-domain (KS-AT) of a mycocerosic acid synthase-like (MAS-like) PKS
  2HG4	47%	Saccharopolyspora erythraea	Structure of the ketosynthase-acyltransferase didomain of module 5 from DEBS.
  4MZ0	46%	Moorea producens 3L	Structure of a ketosynthase-acyltransferase di-domain from module CurL of the curacin A polyketide synthase
  2QO3	45%	Saccharopolyspora erythraea	Crystal Structure of [KS3][AT3] didomain from module 3 of 6-deoxyerthronolide B synthase
  6C9U	44%	Saccharopolyspora erythraea	Crystal structure of [KS3][AT3] didomain from module 3 of 6-deoxyerthronolide B synthase in complex with antibody fragment (Fab)
  4TKT	41%	Streptomyces platensis subsp. rosaceus	Streptomyces platensis isomigrastatin ketosynthase domain MgsF KS6
  6MHK	41%	Bacillus amyloliquefaciens	Crystal structure of ketosynthase nine from bacillaene polyketide synthase in Bacillus amyloliquefaciens
  4QYR	40%	Streptomyces platensis subsp. rosaceus	Streptomyces platensis isomigrastatin ketosynthase domain MgsE KS3
  4ZDN	40%	Streptomyces platensis subsp. rosaceus	Streptomyces platensis isomigrastatin ketosynthase domain MgsF KS4
  4OPE	39%	Streptomyces albus	Streptomcyes albus JA3453 oxazolomycin ketosynthase domain OzmH KS7

• Links to additional information on pks3:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = ? (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

VRTATATSVAVIGMACRLPGGIDSPQRLWEALLRGDDLVGEIPADRWDANVYYDPEPGVPGRSVSRWGAFLDDVGGFDCDFFGLTEREATAIDPQHRLLL
EVSWEAIEHAGVDPATLAESQTGVFVGLTHGDYELLSADCGAAEGPYGFTGTSNSFASGRVAYTLGLHGPAVTVDTACSSGLTAVHQACRSLDDGESDLA
LAGGVVVTLEPRKSVSGSLQGMLSPTGRCHAFDEAADGFVSGEGCVVLLLKRLPDAVRDGDRVLAIVRGTAANQDGRTVNIAAPSAQAQIAVYQQALAAA
GVEASTVGMVEAHGTGTPVGDPVEYASLAAVYGTEGPCALTSVKTNFGHLQSASGPLGLMKTILALRHGVVPQNLHFCRLPDQLAEIDTELFVPQANTSW
PDNTGQPRRAAVSSYGMSGTNVHAILEQAPVSEPAASGPELTPEAGGLALFPVSATSAEQLHVTAARLADWVDQNGNAGSRVSMRDLG

Additional Information