TB Genome Annotation Portal

Rv1170 (mshB)

Amino Acid Sequence

MSETPRLLFVHAHPDDESLSNGATIAHYTSRGAQVHVVTCTLGEEGEVIGDRWAQLTADHADQLGGYRIGELTAALRALGVSAPIYLGGAGRWRDSGMAG
TDQRSQRRFVDADPRQTVGALVAIIRELRPHVVVTYDPNGGYGHPDHVHTHTVTTAAVAAAGVGSGTADHPGDPWTVPKFYWTVLGLSALISGARALVPD
DLRPEWVLPRADEIAFGYSDDGIDAVVEADEQARAAKVAALAAHATQVVVGPTGRAAALSNNLALPILADEHYVLAGGSAGARDERGWETDLLAGLGFTA
SGT
(Nucleotide sequence available on KEGG)

Additional Information




Analysis of Positive Selection in Clinical Isolates *new*

Moldova (2,057)global set (5,195)
under significant positive selection?NONO
omega peak height (95%CI lower bound)2.37 (0.47)1.24 (0.57)
codons under selection
omega plots
genetic variantslinklink
statistics at each codonlinklink

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Non-Essential Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
2 non-insertions in a row out of 11 sites
Non-Essential Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
2 non-insertions in a row out of 11 sites
Non-Essential Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
2 non-insertions in a row out of 11 sites
Uncertain minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.011050;
6 non-insertions in a row out of 12 sites
Non-Essential minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
2 non-insertions in a row out of 12 sites
Non-Essential 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Non-Essential C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: 0.87
Non-Essential 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv1170 (mshB)

    PropertyValueCreatorEvidencePMIDComment
    TermTBRXN:IGAMD 1D-myo-inositol 2-Acetamido-2-deoxy-D-glucopyranoside deacetylase - ISSnjamshidiISS11092856|14698305see PMID: 11092856, 14698305
    GL. Newton, Y. Av-Gay et al. N-Acetyl-1-D-myo-inosityl-2-amino-2-deoxy-alpha-D-glucopyranoside deacetylase (MshB) is a key enzyme in mycothiol biosynthesis. J. Bacteriol. 2000
    CitationCrystal structure of MshB from Mycobacterium tuberculosis, a deacetylase involved in mycothiol biosynthesis. AA. McCarthy, NA. Peterson et al. J. Mol. Biol. 2004njamshidiISS11092856|14698305see PMID: 11092856, 14698305
    TermTBRXN:IGAMD 1D-myo-inositol 2-Acetamido-2-deoxy-D-glucopyranoside deacetylase - ISSnjamshidiISS11092856|14698305see PMID: 11092856, 14698305
    AA. McCarthy, NA. Peterson et al. Crystal structure of MshB from Mycobacterium tuberculosis, a deacetylase involved in mycothiol biosynthesis. J. Mol. Biol. 2004
    CitationN-Acetyl-1-D-myo-inosityl-2-amino-2-deoxy-alpha-D-glucopyranoside deacetylase (MshB) is a key enzyme in mycothiol biosynthesis. GL. Newton, Y. Av-Gay et al. J. Bacteriol. 2000njamshidiIDA11092856|14698305see PMID: 11092856, 14698305
    TermTBRXN:IGAMD 1D-myo-inositol 2-Acetamido-2-deoxy-D-glucopyranoside deacetylase - IDAnjamshidiIDA11092856|14698305see PMID: 11092856, 14698305
    GL. Newton, Y. Av-Gay et al. N-Acetyl-1-D-myo-inosityl-2-amino-2-deoxy-alpha-D-glucopyranoside deacetylase (MshB) is a key enzyme in mycothiol biosynthesis. J. Bacteriol. 2000
    CitationCrystal structure of MshB from Mycobacterium tuberculosis, a deacetylase involved in mycothiol biosynthesis. AA. McCarthy, NA. Peterson et al. J. Mol. Biol. 2004njamshidiIDA11092856|14698305see PMID: 11092856, 14698305
    TermTBRXN:IGAMD 1D-myo-inositol 2-Acetamido-2-deoxy-D-glucopyranoside deacetylase - IDAnjamshidiIDA11092856|14698305see PMID: 11092856, 14698305
    AA. McCarthy, NA. Peterson et al. Crystal structure of MshB from Mycobacterium tuberculosis, a deacetylase involved in mycothiol biosynthesis. J. Mol. Biol. 2004
    CitationN-Acetyl-1-D-myo-inosityl-2-amino-2-deoxy-alpha-D-glucopyranoside deacetylase (MshB) is a key enzyme in mycothiol biosynthesis. GL. Newton, Y. Av-Gay et al. J. Bacteriol. 2000njamshidiISS11092856|14698305see PMID: 11092856, 14698305
    CitationThe glycosyltransferase gene encoding the enzyme catalyzing the first step of mycothiol biosynthesis (mshA). GL. Newton, T. Koledin et al. J. Bacteriol. 2003jjmcfadden12754249Inferred from direct assay
    OtherEC:jjmcfaddenInferred from direct assay
    GL. Newton, T. Koledin et al. The glycosyltransferase gene encoding the enzyme catalyzing the first step of mycothiol biosynthesis (mshA). J. Bacteriol. 2003

    Comments