Rv1170 (mshB)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: 1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside deacetylase
- REFSEQ: N-Acetyl-1-D-myo-Inosityl-2-amino-2-deoxy-alpha- D-glucopyranoside deacetylase mshB (GlcNAc-Ins deacetylase)
- PATRIC: N-acetyl-1-D-myo-inosityl-2-amino-2-deoxy-alpha-D-glucopyranoside deacetylase MshB
- TUBERCULIST: N-acetyl-1-D-myo-inosityl-2-amino-2-deoxy-alpha-D-glucopyranoside deacetylase MshB (GlcNAc-Ins deacetylase)
- NCBI: N-acetyl-1-D-myo-inosityl-2-amino-2-deoxy-alpha- D-glucopyranoside deacetylase MshB (GlcNAc-Ins deacetylase)
- updated information (H37Rv4):
  - gene name: mshB
  - function:
  - reference:
Type: Not Target
Start: 1300304
End: 1301215
Operon:

Trans-membrane region:
Role: IV.D - Antibiotic production and resistance
GO terms:
- GO:0046872 - metal ion binding (Uniprot)
- GO:0035595 - N-acetylglucosaminylinositol deacetylase activity (Uniprot)
- GO:0016811 - hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides (Uniprot)
- GO:0016787 - hydrolase activity (Uniprot)
- GO:0010125 - mycothiol biosynthetic process (Uniprot)
- GO:0008270 - zinc ion binding (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
- NAG_INS[c] -> AC[c] + NG_INS[c]
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure: 1q7t, 4ewl, 1q74
Search for Homologs in PDB

Top 10 Homologs in PDB (as of Nov 2020):

PDB	aa ident	species	PDB title
4EWL	100%	Mycobacterium tuberculosis	Crystal Structure of MshB with glycerol and Acetate bound in the active site
1Q7T	100%	Mycobacterium tuberculosis	Rv1170 (MshB) from Mycobacterium tuberculosis
1Q74	100%	Mycobacterium tuberculosis	The Crystal Structure of 1D-myo-inositol 2-acetamido-2-deoxy-alpha-D-glucopyranoside Deacetylase (MshB)

Links to additional information on mshB:
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 0.311 (from Jeremy Rock's lab)

Amino Acid Sequence

MSETPRLLFVHAHPDDESLSNGATIAHYTSRGAQVHVVTCTLGEEGEVIGDRWAQLTADHADQLGGYRIGELTAALRALGVSAPIYLGGAGRWRDSGMAG
TDQRSQRRFVDADPRQTVGALVAIIRELRPHVVVTYDPNGGYGHPDHVHTHTVTTAAVAAAGVGSGTADHPGDPWTVPKFYWTVLGLSALISGARALVPD
DLRPEWVLPRADEIAFGYSDDGIDAVVEADEQARAAKVAALAAHATQVVVGPTGRAAALSNNLALPILADEHYVLAGGSAGARDERGWETDLLAGLGFTA
SGT

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Non-Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 11 sites
Non-Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 11 sites
Non-Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 11 sites
Uncertain	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.011050; 6 non-insertions in a row out of 12 sites
Non-Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 12 sites
Non-Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Non-Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 0.87
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0081 (-)
- Rv3223c (sigH)

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0023 (-) (Direct binding)
- Rv0135c (-) (Direct binding)
- Rv0602c (tcrA) (Direct binding)
- Rv0967 (csoR) (Direct binding)
- Rv1167c (-) (Direct binding)
- Rv2011c (-) (Direct binding)
- Rv3133c (devR) (Direct binding)
- Rv3246c (mtrA) (Direct binding)
- Rv3597c (lsr2) (Direct binding)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Rv0081 (-)
- Rv3676 (crp)
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Rv3223c (sigH)

Property	Value	Creator	Evidence	PMID	Comment
Term	TBRXN:IGAMD 1D-myo-inositol 2-Acetamido-2-deoxy-D-glucopyranoside deacetylase - ISS	njamshidi	ISS	11092856\|14698305	see PMID: 11092856, 14698305 GL. Newton, Y. Av-Gay et al. N-Acetyl-1-D-myo-inosityl-2-amino-2-deoxy-alpha-D-glucopyranoside deacetylase (MshB) is a key enzyme in mycothiol biosynthesis. J. Bacteriol. 2000
Citation	Crystal structure of MshB from Mycobacterium tuberculosis, a deacetylase involved in mycothiol biosynthesis. AA. McCarthy, NA. Peterson et al. J. Mol. Biol. 2004	njamshidi	ISS	11092856\|14698305	see PMID: 11092856, 14698305
Term	TBRXN:IGAMD 1D-myo-inositol 2-Acetamido-2-deoxy-D-glucopyranoside deacetylase - ISS	njamshidi	ISS	11092856\|14698305	see PMID: 11092856, 14698305 AA. McCarthy, NA. Peterson et al. Crystal structure of MshB from Mycobacterium tuberculosis, a deacetylase involved in mycothiol biosynthesis. J. Mol. Biol. 2004
Citation	N-Acetyl-1-D-myo-inosityl-2-amino-2-deoxy-alpha-D-glucopyranoside deacetylase (MshB) is a key enzyme in mycothiol biosynthesis. GL. Newton, Y. Av-Gay et al. J. Bacteriol. 2000	njamshidi	IDA	11092856\|14698305	see PMID: 11092856, 14698305
Term	TBRXN:IGAMD 1D-myo-inositol 2-Acetamido-2-deoxy-D-glucopyranoside deacetylase - IDA	njamshidi	IDA	11092856\|14698305	see PMID: 11092856, 14698305 GL. Newton, Y. Av-Gay et al. N-Acetyl-1-D-myo-inosityl-2-amino-2-deoxy-alpha-D-glucopyranoside deacetylase (MshB) is a key enzyme in mycothiol biosynthesis. J. Bacteriol. 2000
Citation	Crystal structure of MshB from Mycobacterium tuberculosis, a deacetylase involved in mycothiol biosynthesis. AA. McCarthy, NA. Peterson et al. J. Mol. Biol. 2004	njamshidi	IDA	11092856\|14698305	see PMID: 11092856, 14698305
Term	TBRXN:IGAMD 1D-myo-inositol 2-Acetamido-2-deoxy-D-glucopyranoside deacetylase - IDA	njamshidi	IDA	11092856\|14698305	see PMID: 11092856, 14698305 AA. McCarthy, NA. Peterson et al. Crystal structure of MshB from Mycobacterium tuberculosis, a deacetylase involved in mycothiol biosynthesis. J. Mol. Biol. 2004
Citation	N-Acetyl-1-D-myo-inosityl-2-amino-2-deoxy-alpha-D-glucopyranoside deacetylase (MshB) is a key enzyme in mycothiol biosynthesis. GL. Newton, Y. Av-Gay et al. J. Bacteriol. 2000	njamshidi	ISS	11092856\|14698305	see PMID: 11092856, 14698305
Citation	The glycosyltransferase gene encoding the enzyme catalyzing the first step of mycothiol biosynthesis (mshA). GL. Newton, T. Koledin et al. J. Bacteriol. 2003	jjmcfadden		12754249	Inferred from direct assay
Other	EC:	jjmcfadden			Inferred from direct assay GL. Newton, T. Koledin et al. The glycosyltransferase gene encoding the enzyme catalyzing the first step of mycothiol biosynthesis (mshA). J. Bacteriol. 2003

TB Genome Annotation Portal