TB Genome Annotation Portal

Rv1151c (-)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: NAD-dependent deacetylase
  • REFSEQ: NAD-dependent deacetylase
  • PATRIC: NAD-dependent protein deacetylase of SIR2 family
  • TUBERCULIST: Transcriptional regulatory protein
  • NCBI: Transcriptional regulatory protein
  • updated information (H37Rv4):
    • gene name: -
    • function:
    • reference:
• Type: Not Target
• Start: 1278904
• End: 1279617
• Operon:


• Trans-membrane region:
  
• Role: I.J.1 - Repressors/activators
• GO terms:
  • GO:0070403 - NAD+ binding (Uniprot)
  • GO:0070213 - protein auto-ADP-ribosylation (Uniprot)
  • GO:0046872 - metal ion binding (Uniprot)
  • GO:0036055 - protein-succinyllysine desuccinylase activity (Uniprot)
  • GO:0036054 - protein-malonyllysine demalonylase activity (Uniprot)
  • GO:0036049 - peptidyl-lysine desuccinylation (Uniprot)
  • GO:0036047 - peptidyl-lysine demalonylation (Uniprot)
  • GO:0034979 - NAD-dependent protein deacetylase activity (Uniprot)
  • GO:0016787 - hydrolase activity (Uniprot)
  • GO:0016740 - transferase activity (Uniprot)
  • GO:0006974 - cellular response to DNA damage stimulus (Uniprot)
  • GO:0006476 - protein deacetylation (Uniprot)
  • GO:0006281 - DNA repair (Uniprot)
  • GO:0005737 - cytoplasm (Uniprot)
  • GO:0005618 - cell wall (Uniprot)
  • GO:0003953 - NAD+ nucleosidase activity (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  4TWI	46%	Archaeoglobus fulgidus	The structure of Sir2Af1 bound to a succinylated histone peptide
  1M2G	46%	Archaeoglobus fulgidus	Sir2 homologue-ADP ribose complex
  1ICI	46%	Archaeoglobus fulgidus	CRYSTAL STRUCTURE OF A SIR2 HOMOLOG-NAD COMPLEX
  1M2K	45%	Archaeoglobus fulgidus	Sir2 homologue F159A mutant-ADP ribose complex
  1M2J	45%	Archaeoglobus fulgidus	Sir2 homologue H80N mutant-ADP ribose complex
  1M2H	45%	Archaeoglobus fulgidus	Sir2 homologue S24A mutant-ADP ribose complex
  1M2N	45%	Archaeoglobus fulgidus	Sir2 homologues (D102G/F159A/R170A) mutant-2'-O-acetyl ADP ribose complex
  4TWJ	42%	Archaeoglobus fulgidus	The structure of Sir2Af2 bound to a myristoylated histone peptide
  1YC2	42%	Archaeoglobus fulgidus	Sir2Af2-NAD-ADPribose-nicotinamide
  1S7G	42%	Archaeoglobus fulgidus	Structural Basis for the Mechanism and Regulation of Sir2 Enzymes

• Links to additional information on Rv1151c:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.433 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MRVAVLSGAGISAESGVPTFRDDKNGLWARFDPYELSSTQGWLRNPERVWGWYLWRHYLVANVEPNDGHRAIAAWQDHAEVSVITQNVDDLHERAGSGAV
HHLHGSLFEFRCARCGVPYTDALPEMPEPAIEVEPPVCDCGGLIRPDIVWFGEPLPEEPWRSAVEATGSADVMVVVGTSAIVYPAAGLPDLALARGTAVI
EVNPEPTPLSGSATISIRESASQALPGLLERLPALLK

Additional Information