TB Genome Annotation Portal

Rv1142c (echA10)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: enoyl-CoA hydratase
  • REFSEQ: enoyl-CoA hydratase
  • PATRIC: Enoyl-CoA hydratase (EC 4.2.1.17)
  • TUBERCULIST: Probable enoyl-CoA hydratase EchA10 (enoyl hydrase) (unsaturated acyl-CoA hydratase) (crotonase)
  • NCBI: Probable enoyl-CoA hydratase EchA10 (enoyl hydrase) (unsaturated acyl-CoA hydratase) (crotonase)
  • updated information (H37Rv4):
    • gene name: echA10
    • function:
    • reference:
• Type: Not Target
• Start: 1269152
• End: 1269958
• Operon:


• Trans-membrane region:
  
• Role: I.A.3 - Fatty acids
• GO terms:
  • GO:0008152 - metabolic process (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005829 - cytosol (Uniprot)
  • GO:0003824 - catalytic activity (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • TRANS_DELTA_2_ENOYL_C22_ACYL_ACP[c] -> CIS_DELTA_3_ENOYL_C22_ACYL_ACP[c]
  • NADPH[c] + MALACP[c] + CIS_DELTA_13_ENOYL_C32_ACYL_ACP[c] -> NADP[c] + CO2[c] + ACP[c] + CIS_DELTA_2_3_44_15_ENOYL_C34_ACYL_ACP... <Preview truncated at 128 characters>
  • NADPH[c] + MALACP[c] + CIS_DELTA_19_ENOYL_C38_ACYL_ACP[c] -> NADP[c] + CO2[c] + ACP[c] + CIS_DELTA_2_3_44_21_ENOYL_C40_ACYL_ACP... <Preview truncated at 128 characters>
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  4LK5	71%	Mycobacterium avium subsp. paratuberculosis	Crystal structure of a enoyl-CoA hydratase from Mycobacterium avium subsp. paratuberculosis K-10
  3P5M	45%	Mycobacterium avium	Crystal structure of an enoyl-CoA hydratase/isomerase from Mycobacterium avium
  6SLB	37%	Thermus thermophilus JL-18	Crystal structure of isomerase PaaG with trans-3,4-didehydroadipyl-CoA
  6SL9	37%	Thermus thermophilus JL-18	High resolution apo structure of isomerase PaaG
  3HRX	37%	Thermus thermophilus	Crystal structure of phenylacetic acid degradation protein PaaG
  6SLA	37%	Thermus thermophilus JL-18	Crystal structure of isomerase PaaG mutant - D136N with Oxepin-CoA
  2EJ5	36%	Geobacillus kaustophilus	Crystal structure of GK2038 protein (enoyl-CoA hydratase subunit II) from Geobacillus kaustophilus
  3G64	36%	Streptomyces coelicolor A3(2)	Crystal structure of putative enoyl-CoA hydratase from Streptomyces coelicolor A3(2)
  5E0N	35%	Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)	Crystal Structure of MSMEG_3139, a monofunctional enoyl CoA isomerase from M.smegmatis
  4NNQ	35%	Streptomyces atroolivaceus	Crystal structure of LnmF protein from Streptomyces amphibiosporus

• Links to additional information on echA10:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.81 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MSNYRIDTRTIVPGLAVTLADGVLSVTIDRPESLNSLTKPVLAGMADAIEGAATDPRVKVVRLGGAGRGFSSGGAISVDDVWASGPPTDTVAEANRTVRA
IVALPQPVVAVVQGPTVGCGVSLALACDLVLASDNAFFMLAHTNVGLMPDGGASALVQAAIGRIRAMHMALLPDRVPAAEALSWGLVSAVYPAADFDAEV
DKLISRLLAGPALAIAKTKNAINAATLTELAPTLLRELDGQALLLRTDDFAEGATAFQQRRTPMFTGR

Additional Information