Rv1138c (-)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: oxidoreductase
- REFSEQ: oxidoreductase
- PATRIC: PUTATIVE OXIDOREDUCTASE
- TUBERCULIST: Possible oxidoreductase
- NCBI: Possible oxidoreductase
- updated information (H37Rv4):
  - gene name: -
  - function:
  - reference:
Type: Not Target
Start: 1265472
End: 1266488
Operon:

Trans-membrane region:
Role: V - Conserved hypotheticals
GO terms:
- GO:0071949 - FAD binding (Uniprot)
- GO:0005829 - cytosol (Uniprot)
- GO:0005618 - cell wall (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
Links to additional information on Rv1138c:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 0.79 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

MTSYDTDLLVVGGGPGGLATALHARARGLSVIVAEPRENPIDKACGEGLMPGGLAELTSLGVDPVGLPFHGIAYVGEHRRVQARFRTGPGRGVRRTTLHA
ALAARAKEQDTEWIRSRVATIQQDAHGVTAAGVRAKWLVAADGLHSAVRRAVGIKATAGTPRRYGVRWHYRLPVWSDFVEVHWSRWGEAYVTPVEPDLVG
VAILSRQRPELAWFPSLAHHLQDASRGHARGCGPLRQVVSRRVAGRVLLVGDAAGYEDALTGEGISLAVKQAAAAVSAIVDDTPASYEAAWHRITRDYRL
VTRGLVLASTPRAARRAIVPLCALLPTAFRYGVNILAY

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Non-Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 4 non-insertions in a row out of 16 sites
Non-Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 4 non-insertions in a row out of 16 sites
Non-Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 3 non-insertions in a row out of 16 sites
Non-Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 4 non-insertions in a row out of 16 sites
Non-Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 16 sites
Non-Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Non-Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 1.2
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0576 (-)
- Rv0735 (sigL)

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv1404 (-) (Upstream of operon)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Rv0735 (sigL)
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Rv0576 (-)

Property	Value	Creator	Evidence	PMID	Comment
Interaction	Transcription Rv1139c	ashwinigbhat	NAS		Operon (Functional Linkage) authors,JD. Romano,S. Michaelis Topological and mutational analysis of Saccharomyces cerevisiae Ste14p, founding member of the isoprenylcysteine carboxyl methyltransferase family. Mol. Biol. Cell 2001
Interaction	Transcription Rv1139c	ashwinigbhat	NAS		Operon (Functional Linkage) MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
Interaction	Transcription Rv1139c	ashwinigbhat	NAS		Operon (Functional Linkage) authors,B. Karlmark,B. Agerup,PJ. Wistrand Renal proximal tubular acidification. Role of brush-border and cytoplasmic carbonic anhydrase. Acta Physiol. Scand. 1979
Citation	The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. MY. Hahn, S. Raman et al. J. Bacteriol. 2005	priyadarshinipriyanka2001	NAS	16199577	Operon (Functional Linkage)
Interaction	Transcription Rv1139c	priyadarshinipriyanka2001	NAS		Operon (Functional Linkage) MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
Citation	The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. MY. Hahn, S. Raman et al. J. Bacteriol. 2005	ashwinigbhat	IEP	16199577	Co-expression (Functional linkage)
Interaction	Regulatory Rv0735	ashwinigbhat	IEP		Co-expression (Functional linkage) MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
Citation	The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. MY. Hahn, S. Raman et al. J. Bacteriol. 2005	aparna.vchalam	NAS	16199577	Operon (Functional Linkage)
Interaction	Transcription Rv1139c	aparna.vchalam	NAS		Operon (Functional Linkage) MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005

TB Genome Annotation Portal