TB Genome Annotation Portal

Rv1131 (prpC)

Amino Acid Sequence

MTGPLAAARSVAATKSMTAPTVDERPDIKKGLAGVVVDTTAISKVVPQTNSLTYRGYPVQDLAARCSFEQVAFLLWRGELPTDAELALFSQRERASRRVD
RSMLSLLAKLPDNCHPMDVVRTAISYLGAEDPDEDDAAANRAKAMRMMAVLPTIVAIDMRRRRGLPPIAPHSGLGYAQNFLHMCFGEVPETAVVSAFEQS
MILYAEHGFNASTFAARVVTSTQSDIYSAVTGAIGALKGRLHGGANEAVMHDMIEIGDPANAREWLRAKLARKEKIMGFGHRVYRHGDSRVPTMKRALER
VGTVRDGQRWLDIYQVLAAEMASATGILPNLDFPTGPAYYLMGFDIASFTPIFVMSRITGWTAHIMEQATANALIRPLSAYCGHEQRVLPGTF
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv1131/prpC, gene len: 1181 bp, num TA sites: 17
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBionon-essential7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Micronon-essential 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASnon-essential BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathnon-essentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathnon-essentialM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathYES (LFC=-3.98)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifenon-essential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifenon-essentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=0.39)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysnon-essentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysnon-essentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=2.43)YM rich vs minimal mediumresampling

Analysis of Positive Selection in Clinical Isolates *new*

global set of 10,626 Mtb clinical isolates
under significant positive selection?NO
omega peak height (95%CI lower bound)0.59 (0.17)
codons under selection
omega plotsomega plot across ORF
genetic variants*link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"



TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: see table of TFOE interactions below

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)

    TFOE = Transcription Factor Over-Expression study
    significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01

    genedysregulated by OE ofLFC
    Rv1131/prpCRv0260c/nnaR4.11
    Rv1131/prpCRv1453/-4.09
    Rv1131/prpCRv3862c/whiB64.09
    Rv1131/prpCRv3223c/sigH3.52
    Rv1131/prpCRv3416/whiB33.33
    Rv1131/prpCRv2827c/-2.98
    Rv1131/prpCRv0238/fdmR2.82
    Rv1131/prpCRv0165c/mce1R2.81
    Rv1131/prpCRv0182c/sigG2.5
    Rv1131/prpCRv3055/-2.48
    Rv1131/prpCRv0117/oxyS2.37
    Rv1131/prpCRv3050c/-2.03
    Rv1131/prpCRv3574/kstR1.52
    Rv1131/prpCRv3133c/dosR/devR1.36


    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv1131 (prpC)

    PropertyValueCreatorEvidencePMIDComment
    InteractionRegulatory Rv1129canshula.arora1990NASco-expression
    X. Pang, P. Vu et al. Evidence for complex interactions of stress-associated regulons in an mprAB deletion mutant of Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2007
    InteractionTranscription Rv1132ashwinigbhatIDACoexpression (Real Time semiquantitative RT-PCR)
    authors,MA. Fisher,BB. Plikaytis,TM. Shinnick Microarray analysis of the Mycobacterium tuberculosis transcriptional response to the acidic conditions found in phagosomes. J. Bacteriol. 2002
    InteractionRegulatedBy Rv0981yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    H. He, R. Hovey et al. MprAB is a stress-responsive two-component system that directly regulates expression of sigma factors SigB and SigE in Mycobacterium tuberculosis. J. Bacteriol. 2006
    InteractionRegulatedBy Rv0757yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
    InteractionRegulatedBy Rv1221yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
    InteractionRegulatedBy Rv1221yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
    InteractionRegulatedBy Rv0491yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
    CitationRole of the methylcitrate cycle in Mycobacterium tuberculosis metabolism, intracellular growth, and virulence. EJ. Muoz-Elas, AM. Upton et al. Mol. Microbiol. 2006jjmcfadden16689789Inferred from direct assay
    TermEC:4.1.3.31 Transferred entry: 2.3.3.5. - NRjjmcfaddenNRInferred from direct assay
    EJ. Muoz-Elas, AM. Upton et al. Role of the methylcitrate cycle in Mycobacterium tuberculosis metabolism, intracellular growth, and virulence. Mol. Microbiol. 2006
    TermEC:2.3.3.1 Citrate (Si)-synthase. - NRjjmcfaddenNRInferred from direct assay
    EJ. Muoz-Elas, AM. Upton et al. Role of the methylcitrate cycle in Mycobacterium tuberculosis metabolism, intracellular growth, and virulence. Mol. Microbiol. 2006
    CitationCentral carbon metabolism in Mycobacterium tuberculosis: an unexpected frontier. authors,KY. Rhee,LP. de Carvalho,R. Bryk,S. Ehrt,J. Marrero,SW. Park,D. Schnappinger,A. Venugopal,C. Nathan Trends Microbiol. 2011extern:JZUCKER21561773Traceable author statement to experimental support
    TermEC:2.3.3.1 Citrate (Si)-synthase. - NRextern:JZUCKERNRTraceable author statement to experimental support
    authors,KY. Rhee,LP. de Carvalho,R. Bryk,S. Ehrt,J. Marrero,SW. Park,D. Schnappinger,A. Venugopal,C. Nathan Central carbon metabolism in Mycobacterium tuberculosis: an unexpected frontier. Trends Microbiol. 2011
    TermEC:2.3.3.5 2-methylcitrate synthase. - NRextern:JZUCKERNRTraceable author statement to experimental support
    authors,KY. Rhee,LP. de Carvalho,R. Bryk,S. Ehrt,J. Marrero,SW. Park,D. Schnappinger,A. Venugopal,C. Nathan Central carbon metabolism in Mycobacterium tuberculosis: an unexpected frontier. Trends Microbiol. 2011
    CitationRole of the methylcitrate cycle in Mycobacterium tuberculosis metabolism, intracellular growth, and virulence. EJ. Muoz-Elas, AM. Upton et al. Mol. Microbiol. 2006extern:JZUCKER16689789Assay of protein purified to homogeneity from its native host
    TermEC:2.3.3.1 Citrate (Si)-synthase. - NRextern:JZUCKERNRAssay of protein purified to homogeneity from its native host
    EJ. Muoz-Elas, AM. Upton et al. Role of the methylcitrate cycle in Mycobacterium tuberculosis metabolism, intracellular growth, and virulence. Mol. Microbiol. 2006
    TermEC:2.3.3.5 2-methylcitrate synthase. - NRextern:JZUCKERNRAssay of protein purified to homogeneity from its native host
    EJ. Muoz-Elas, AM. Upton et al. Role of the methylcitrate cycle in Mycobacterium tuberculosis metabolism, intracellular growth, and virulence. Mol. Microbiol. 2006

    Comments