Rv1119c (-)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: hypothetical protein
- REFSEQ: hypothetical protein
- PATRIC: hypothetical protein Rv1119c
- TUBERCULIST: Hypothetical protein
- NCBI: Hypothetical protein
- updated information (H37Rv4):
  - gene name: -
  - function:
  - reference:
Type: Not Target
Start: 1242864
End: 1243013
Operon:

Trans-membrane region:
Role: VI - Unknowns
GO terms:
- No terms assigned.
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB

Top 10 Homologs in PDB (as of Nov 2020):

PDB	aa ident	species	PDB title
5D15	48%	Mycobacterium avium subsp. avium 10-9275	Crystal structure of an adenylyl cyclase Ma1120 from Mycobacterium avium in complex with ATP and calcium ion
5D0E	48%	Mycobacterium avium subsp. avium 10-9275	Crystal Structure of an adenylyl cyclase Ma1120-Cat in complex with GTP and calcium from Mycobacterium avium
4WP9	48%	Mycobacterium avium	Crystal structure of Adenylyl cyclase MA1120 from Mycobacterium Avium bound to 2'5'-DD-3'-ATP, Calcium and Magnesium ion
4WP3	48%	Mycobacterium avium	Crystal Structure of Adenylyl cyclase from Mycobacterium avium Ma1120 wild type
4WPA	48%	Mycobacterium avium	Crystal structure of Adenylyl cyclase Ma1120 from Mycobacterium Avium bound to Pyrophosphate and Calcium
4WP8	48%	Mycobacterium avium	Crystal structure of Adenylyl cyclase Ma1120 from Mycobacterium Avium in complex with 2'5'-DD-3'-ATP and Manganese ion
5D0H	46%	Mycobacterium avium subsp. avium 10-9275	Crystal Structure of triple mutant (KDA to EGY) of an adenylyl cyclase Ma1120 from Mycobacterium avium in complex with ATP and calcium ion
5D0G	46%	Mycobacterium avium subsp. avium 10-9275	Crystal structure of triple mutant (KDA to EGY) of adenylyl cyclase Ma1120 from Mycobacterium avium in complex with GTP and calcium ion

Links to additional information on Rv1119c:
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 1.025 (from Jeremy Rock's lab)

Amino Acid Sequence

MTARVAGQAVGGQILVGEPVHDAVSDCADIRFGSYRLFSLDAAPGPDLD

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Too-Short	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: -1.000000; 3 non-insertions in a row out of 3 sites
Too-Short	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: -1.000000; 3 non-insertions in a row out of 3 sites
Too-Short	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: -1.000000; 2 non-insertions in a row out of 3 sites
Too-Short	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: -1.000000; 2 non-insertions in a row out of 3 sites
Too-Short	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: -1.000000; 2 non-insertions in a row out of 3 sites
Non-Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Non-Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 0.48
Uncertain	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

RNA processing and modification

Energy production and conversion

Chromatin structure and dynamics

Amino acid transport and metabolism

Cell cycle control, cell division, chromosome partitioning

Carbohydrate transport and metabolism

Nucleotide transport and metabolism

Lipid transport and metabolism

Coenzyme transport and metabolism

Transcription

Translation, ribosomal structure and biogenesis

Cell wall/membrane/envelope biogenesis

Replication, recombination and repair

Posttranslational modification, protein turnover, chaperones

Cell motility

Secondary metabolites biosynthesis, transport and catabolism

Inorganic ion transport and metabolism

Function unknown

General function prediction only

Intracellular trafficking, secretion, and vesicular transport

Signal transduction mechanisms

Extracellular structures

Defense mechanisms

Nuclear structure

Cytoskeleton

BioCyc Co-regulated genes based on gene expression profiling (Systems Biology, Inferelator Network)

Differentially expressed as result of RNASeq in glycerol environment (Only top 20 genes shown sorted by log fold change with p_adj 0.05).

Conditionally essential as result of TNSeq (Only top 20 genes shown sorted by log fold change with p_adj 0.05).

BioCyc Transcription factor binding based on ChIP-Seq (Systems Biology)

Binds To:
- No bindings to other targets were found.
Bound By:
- No bindings from other targets were found.

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0967 (csoR) (Upstream of operon)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Not upregulated by other genes.
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Not downregulated by other genes.

Property	Value	Creator	Evidence	PMID	Comment
Citation	A survey of nucleotide cyclases in actinobacteria: unique domain organization and expansion of the class III cyclase family in Mycobacterium tuberculosis. authors,AR. Shenoy,K. Sivakumar,A. Krupa,N. Srinivasan,SS. Visweswariah Comp. Funct. Genomics 2004	priyadarshinipriyanka2001	ISA	18629044	Operon (Functional Linkage)
Interaction	Transcription Rv1118c	priyadarshinipriyanka2001	ISA		Operon (Functional Linkage) authors,AR. Shenoy,K. Sivakumar,A. Krupa,N. Srinivasan,SS. Visweswariah A survey of nucleotide cyclases in actinobacteria: unique domain organization and expansion of the class III cyclase family in Mycobacterium tuberculosis. Comp. Funct. Genomics 2004
Interaction	Transcription Rv1120c	priyadarshinipriyanka2001	ISA		Operon (Functional Linkage) authors,AR. Shenoy,K. Sivakumar,A. Krupa,N. Srinivasan,SS. Visweswariah A survey of nucleotide cyclases in actinobacteria: unique domain organization and expansion of the class III cyclase family in Mycobacterium tuberculosis. Comp. Funct. Genomics 2004
Citation	An adenylyl cyclase pseudogene in Mycobacterium tuberculosis has a functional ortholog in Mycobacterium avium. AR. Shenoy, A. Srinivas et al. Biochimie 2005	aparna.vchalam	ISA	15908099	Operon (Functional Linkage)
Interaction	Transcription Rv1118c	aparna.vchalam	ISA		Operon (Functional Linkage) AR. Shenoy, A. Srinivas et al. An adenylyl cyclase pseudogene in Mycobacterium tuberculosis has a functional ortholog in Mycobacterium avium. Biochimie 2005
Interaction	Transcription Rv1120c	aparna.vchalam	ISA		Operon (Functional Linkage) AR. Shenoy, A. Srinivas et al. An adenylyl cyclase pseudogene in Mycobacterium tuberculosis has a functional ortholog in Mycobacterium avium. Biochimie 2005
Citation	A survey of nucleotide cyclases in actinobacteria: unique domain organization and expansion of the class III cyclase family in Mycobacterium tuberculosis. authors,AR. Shenoy,K. Sivakumar,A. Krupa,N. Srinivasan,SS. Visweswariah Comp. Funct. Genomics 2004	aparna.vchalam	ISA	18629044	Operon (Functional Linkage)
Interaction	Transcription Rv1118c	aparna.vchalam	ISA		Operon (Functional Linkage) authors,AR. Shenoy,K. Sivakumar,A. Krupa,N. Srinivasan,SS. Visweswariah A survey of nucleotide cyclases in actinobacteria: unique domain organization and expansion of the class III cyclase family in Mycobacterium tuberculosis. Comp. Funct. Genomics 2004
Interaction	Transcription Rv1120c	aparna.vchalam	ISA		Operon (Functional Linkage) authors,AR. Shenoy,K. Sivakumar,A. Krupa,N. Srinivasan,SS. Visweswariah A survey of nucleotide cyclases in actinobacteria: unique domain organization and expansion of the class III cyclase family in Mycobacterium tuberculosis. Comp. Funct. Genomics 2004
Citation	An adenylyl cyclase pseudogene in Mycobacterium tuberculosis has a functional ortholog in Mycobacterium avium. AR. Shenoy, A. Srinivas et al. Biochimie 2005	priyadarshinipriyanka2001	ISA	15908099	Operon (Functional Linkage)
Interaction	Transcription Rv1118c	priyadarshinipriyanka2001	ISA		Operon (Functional Linkage) AR. Shenoy, A. Srinivas et al. An adenylyl cyclase pseudogene in Mycobacterium tuberculosis has a functional ortholog in Mycobacterium avium. Biochimie 2005
Interaction	Transcription Rv1120c	priyadarshinipriyanka2001	ISA		Operon (Functional Linkage) AR. Shenoy, A. Srinivas et al. An adenylyl cyclase pseudogene in Mycobacterium tuberculosis has a functional ortholog in Mycobacterium avium. Biochimie 2005

TB Genome Annotation Portal