TB Genome Annotation Portal

Rv1092c (coaA)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: pantothenate kinase
  • REFSEQ: pantothenate kinase
  • PATRIC: Pantothenate kinase (EC 2.7.1.33)
  • TUBERCULIST: Probable pantothenate kinase CoaA (pantothenic acid kinase)
  • NCBI: Probable pantothenate kinase CoaA (pantothenic acid kinase)
  • updated information (H37Rv4):
    • gene name: coaA/panK
    • function:
    • reference: Evans (2016) PMID: 27676316
• Type: Not Target
• Start: 1219248
• End: 1220186
• Operon:


• Trans-membrane region:
  
• Role: I.G.5 - Pantothenate
• GO terms:
  • GO:0040007 - growth (Uniprot)
  • GO:0016740 - transferase activity (Uniprot)
  • GO:0016310 - phosphorylation (Uniprot)
  • GO:0016301 - kinase activity (Uniprot)
  • GO:0015937 - coenzyme A biosynthetic process (Uniprot)
  • GO:0008152 - metabolic process (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005829 - cytosol (Uniprot)
  • GO:0005737 - cytoplasm (Uniprot)
  • GO:0005524 - ATP binding (Uniprot)
  • GO:0005515 - protein binding (Uniprot)
  • GO:0004594 - pantothenate kinase activity (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • ATP[c] + PNTO[c] -> ADP[c] + 4PPNTO[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure: 3avo, 3avq, 3avp, 3af1, 3af0, 3af3, 3af2, 3af4, 3aez, 2zs9, 2zs7, 4bfz, 4bfy, 4bfx, 4bfw, 4bfv, 4bfu, 4bft, 4bfs, 2zs8, 2ges, 2geu, 2get, 2gev, 2zsf, 2zsd, 2zse, 2zsb, 2zsa
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  4BFZ	100%	MYCOBACTERIUM TUBERCULOSIS	Crystal structure of Mycobacterium tuberculosis PanK in complex with a biaryl inhibitory compound (2b) and phosphate
  4BFY	100%	MYCOBACTERIUM TUBERCULOSIS	Crystal structure of Mycobacterium tuberculosis PanK in complex with a biaryl inhibitory compound (2a) and phosphate
  4BFX	100%	MYCOBACTERIUM TUBERCULOSIS	Crystal structure of Mycobacterium tuberculosis PanK in complex with a triazole inhibitory compound (1f) and phosphate
  4BFW	100%	MYCOBACTERIUM TUBERCULOSIS	Crystal structure of Mycobacterium tuberculosis PanK in complex with a triazole inhibitory compound (1e) and phosphate
  4BFV	100%	MYCOBACTERIUM TUBERCULOSIS	Crystal structure of Mycobacterium tuberculosis PanK in complex with a triazole inhibitory compound (1d) and phosphate
  4BFU	100%	MYCOBACTERIUM TUBERCULOSIS	Crystal structure of Mycobacterium tuberculosis PanK in complex with a triazole inhibitory compound (1c) and phosphate
  4BFT	100%	MYCOBACTERIUM TUBERCULOSIS	Crystal structure of Mycobacterium tuberculosis PanK in complex with a triazole inhibitory compound (1b) and phosphate
  4BFS	100%	MYCOBACTERIUM TUBERCULOSIS	Crystal structure of Mycobacterium tuberculosis PanK in complex with a triazole inhibitory compound (1a)
  3AVQ	100%	Mycobacterium tuberculosis	Pantothenate kinase from Mycobacterium tuberculosis (MtPanK) in complex with N9-Pan
  3AVP	100%	Mycobacterium tuberculosis	Pantothenate kinase from Mycobacterium tuberculosis (MtPanK) in complex with Pantothenol

• Links to additional information on coaA:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -2.786 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MSRLSEPSPYVEFDRRQWRALRMSTPLALTEEELVGLRGLGEQIDLLEVEEVYLPLARLIHLQVAARQRLFAATAEFLGEPQQNPDRPVPFIIGVAGSVA
VGKSTTARVLQALLARWDHHPRVDLVTTDGFLYPNAELQRRNLMHRKGFPESYNRRALMRFVTSVKSGSDYACAPVYSHLHYDIIPGAEQVVRHPDILIL
EGLNVLQTGPTLMVSDLFDFSLYVDARIEDIEQWYVSRFLAMRTTAFADPESHFHHYAAFSDSQAVVAAREIWRTINRPNLVENILPTRPRATLVLRKDA
DHSINRLRLRKL

Additional Information