TB Genome Annotation Portal

Rv1079 (metB)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: cystathionine gamma-synthase
  • REFSEQ: cystathionine gamma-synthase
  • PATRIC: Cystathionine gamma-lyase (EC 4.4.1.1)
  • TUBERCULIST: Cystathionine gamma-synthase MetB (CGS) (O-succinylhomoserine [thiol]-lyase)
  • NCBI: Cystathionine gamma-synthase MetB (CGS) (O-succinylhomoserine [thiol]-lyase)
  • updated information (H37Rv4):
    • gene name: metB
    • function: bifunctional CGL/CGS cystathionine gamma-lyase/synthase
    • reference: Wheeler (2005) PMID: 15576367
• Type: Not Target
• Start: 1204067
• End: 1205233
• Operon:


• Trans-membrane region:
  
• Role: I.D.2 - Aspartate family
• GO terms:
  • GO:0030170 - pyridoxal phosphate binding (Uniprot)
  • GO:0019343 - cysteine biosynthetic process via cystathionine (Uniprot)
  • GO:0019279 - L-methionine biosynthetic process from L-homoserine via cystathionine (Uniprot)
  • GO:0016740 - transferase activity (Uniprot)
  • GO:0009086 - methionine biosynthetic process (Uniprot)
  • GO:0008652 - cellular amino acid biosynthetic process (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005829 - cytosol (Uniprot)
  • GO:0005737 - cytoplasm (Uniprot)
  • GO:0004123 - cystathionine gamma-lyase activity (Uniprot)
  • GO:0003962 - cystathionine gamma-synthase activity (Uniprot)
  • GO:0003824 - catalytic activity (Uniprot)
  • GO:0000096 - sulfur amino acid metabolic process (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • NH3[c] + OBUT[c] + CYS[c] -> LLCT[c]
  • CYS[c] + OSLHSER[c] -> SUCC[c] + LLCT[c]
  • CYS[c] + OAHSER[c] -> AC[c] + LLCT[c]
  • H2S[c] + OAHSER[c] -> AC[c] + HCYS[c]
  • H2S[c] + OSLHSER[c] -> SUCC[c] + HCYS[c]
  • OSLHSER[c] -> SUCC[c] + NH3[c] + OBUT[c]
  • LLCT[c] -> NH3[c] + OBUT[c] + CYS[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  3QI6	86%	Mycobacterium ulcerans	Crystal Structure of Cystathionine gamma-synthase MetB (Cgs) from Mycobacterium ulcerans Agy99
  3QHX	86%	Mycobacterium ulcerans	Crystal Structure of Cystathionine gamma-synthase MetB (Cgs) from Mycobacterium ulcerans Agy99 bound to HEPES
  5X5H	63%	Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)	Crystal structure of metB from Corynebacterium glutamicum
  4IYO	56%	Xanthomonas oryzae pv. oryzae	Crystal structure of cystathionine gamma lyase from Xanthomonas oryzae pv. oryzae (XometC) in complex with E-site serine, A-site serine, A-site external aldimine structure with aminoacrylate and A-site iminopropionate intermediates
  4IYO	56%	Xanthomonas oryzae pv. oryzae	Crystal structure of cystathionine gamma lyase from Xanthomonas oryzae pv. oryzae (XometC) in complex with E-site serine, A-site serine, A-site external aldimine structure with aminoacrylate and A-site iminopropionate intermediates
  4IY7	56%	Xanthomonas oryzae pv. oryzae	crystal structure of cystathionine gamma lyase (XometC) from Xanthomonas oryzae pv. oryzae in complex with E-site serine, A-site external aldimine structure with serine and A-site external aldimine structure with aminoacrylate intermediates
  4IXZ	56%	Xanthomonas oryzae pv. oryzae	Native structure of cystathionine gamma lyase (XometC) from xanthomonas oryzae pv. oryzae at pH 9.0
  4IXS	56%	Xanthomonas oryzae pv. oryzae	Native structure of xometc at ph 5.2
  3E6G	56%	Xanthomonas oryzae pv. oryzae	Crystal structure of XometC, a cystathionine c-lyase-like protein from Xanthomonas oryzae pv.oryzae
  6K1N	55%	Stenotrophomonas maltophilia (strain R551-3)	PLP-bound form of a putative cystathionine gamma-lyase

• Links to additional information on metB:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 1.006 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MSEDRTGHQGISGPATRAIHAGYRPDPATGAVNVPIYASSTFAQDGVGGLRGGFEYARTGNPTRAALEASLAAVEEGAFARAFSSGMAATDCALRAMLRP
GDHVVIPDDAYGGTFRLIDKVFTRWDVQYTPVRLADLDAVGAAITPRTRLIWVETPTNPLLSIADITAIAELGTDRSAKVLVDNTFASPALQQPLRLGAD
VVLHSTTKYIGGHSDVVGGALVTNDEELDEEFAFLQNGAGAVPGPFDAYLTMRGLKTLVLRMQRHSENACAVAEFLADHPSVSSVLYPGLPSHPGHEIAA
RQMRGFGGMVSVRMRAGRRAAQDLCAKTRVFILAESLGGVESLIEHPSAMTHASTAGSQLEVPDDLVRLSVGIEDIADLLGDLEQALG

Additional Information