TB Genome Annotation Portal

Rv1031 (kdpC)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: potassium-transporting ATPase C chain
  • REFSEQ: potassium-transporting ATPase subunit C
  • PATRIC: Potassium-transporting ATPase C chain (EC 3.6.3.12) (TC 3.A.3.7.1)
  • TUBERCULIST: Probable potassium-transporting ATPase C chain KdpC (potassium-translocating ATPase C chain) (ATP phosphohydrolase [potassium-transporting] C chain) (potassium binding and translocating subunit C)
  • NCBI: Probable potassium-transporting ATPase C chain KdpC (potassium-translocating ATPase C chain) (ATP phosphohydrolase [potassium-transporting] C chain) (potassium binding and translocating subunit C)
  • updated information (H37Rv4):
    • gene name: kdpC
    • function:
    • reference:
• Type: Not Target
• Start: 1155853
• End: 1156422
• Operon:


• Trans-membrane region:
  
• Role: III.A.2 - Cations
• GO terms:
  • GO:0099132 - ATP hydrolysis coupled cation transmembrane transport (Uniprot)
  • GO:0071805 - potassium ion transmembrane transport (Uniprot)
  • GO:0016021 - integral component of membrane (Uniprot)
  • GO:0016020 - membrane (Uniprot)
  • GO:0008556 - potassium-transporting ATPase activity (Uniprot)
  • GO:0006813 - potassium ion transport (Uniprot)
  • GO:0006811 - ion transport (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005524 - ATP binding (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  6HRB	45%	Escherichia coli (strain K12)	Cryo-EM structure of the KdpFABC complex in an E2 inward-facing state (state 2)
  6HRA	45%	Escherichia coli (strain K12)	Cryo-EM structure of the KdpFABC complex in an E1 outward-facing state (state 1)
  5MRW	45%	Escherichia coli	Structure of the KdpFABC complex

• Links to additional information on kdpC:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.606 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MRRQLLPALTMLLVFTVITGIVYPLAVTGVGQLFFGDQANGALLERDGQVIGSAHIGQQFTAAKYFHPRPSSAGDGYDAAASSGSNLGPTNEKLLAAVAE
RVTAYRKENNLPADTLVPVDAVTGSGSGLDPAISVVNAKLQAPRVAQARNISIRQVERLIEDHTDARGLGFLGERAVNVLRLNLALDRL

Additional Information

Analysis of Positive Selection in Clinical Isolates *new*

• Analysis of dN/dS (omega) in two collections of Mtb clinical isolates using GenomegaMap (Window model) (see description of methods)
  • Moldova: 2,057 clinical isolates
  • global set: 5,195 clinical isolates from 15 other countries
• In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
• A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.

	Moldova (2,057)	global set (5,195)
under significant positive selection?	NO	NO
omega peak height (95%CI lower bound)	1.91 (0.26)	1.04 (0.44)
codons under selection
omega plots
genetic variants*	link	link
statistics at each codon	link	link