TB Genome Annotation Portal

Rv1029 (kdpA)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: potassium-transporting ATPase A chain
  • REFSEQ: potassium-transporting ATPase subunit A
  • PATRIC: Potassium-transporting ATPase A chain (EC 3.6.3.12) (TC 3.A.3.7.1)
  • TUBERCULIST: Probable potassium-transporting ATPase a chain KdpA (potassium-translocating ATPase a chain) (ATP phosphohydrolase [potassium-transporting] a chain) (potassium binding and translocating subunit A)
  • NCBI: Probable potassium-transporting ATPase a chain KdpA (potassium-translocating ATPase a chain) (ATP phosphohydrolase [potassium-transporting] a chain) (potassium binding and translocating subunit A)
  • updated information (H37Rv4):
    • gene name: kdpA
    • function:
    • reference:
• Type: Not Target
• Start: 1152012
• End: 1153727
• Operon:


• Trans-membrane region:
  
• Role: III.A.2 - Cations
• GO terms:
  • GO:0099132 - ATP hydrolysis coupled cation transmembrane transport (Uniprot)
  • GO:0071805 - potassium ion transmembrane transport (Uniprot)
  • GO:0030955 - potassium ion binding (Uniprot)
  • GO:0016021 - integral component of membrane (Uniprot)
  • GO:0016020 - membrane (Uniprot)
  • GO:0008556 - potassium-transporting ATPase activity (Uniprot)
  • GO:0006813 - potassium ion transport (Uniprot)
  • GO:0006811 - ion transport (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005618 - cell wall (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  6HRB	50%	Escherichia coli (strain K12)	Cryo-EM structure of the KdpFABC complex in an E2 inward-facing state (state 2)
  6HRA	50%	Escherichia coli (strain K12)	Cryo-EM structure of the KdpFABC complex in an E1 outward-facing state (state 1)
  5MRW	50%	Escherichia coli	Structure of the KdpFABC complex

• Links to additional information on kdpA:
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 1.253 (from Jeremy Rock's lab)

Amino Acid Sequence

MSGTSWLQFAALIAVLLLTAPALGGYLAKIYGDEAKKPGDRVFGPIERVIYQVCRVDPGSEQRWSTYALSVLAFSVMSFLLLYGIARFQGVLPFNPTDKP
AVTDHVAFNAAVSFMTNTNWQSYSGEATMSHFTQMTGLAVQNFVSASAGMCVLAALIRGLARKRASTLGNFWVDLARTVLRIMFPLSFVVAILLVSQGVI
QNLHGFIVANTLEGAPQLIPGGPVASQVAIKQLGTNGGGFFNVNSAHPFENYTPIGNFVENWAILIIPFALCFAFGKMVHDRRQGWAVLAIMGIIWIGMS
VAAMSFEAKGNPRLDALGVTQQTTVDQSGGNLEGKEVRFGVGASGLWAASTTGTSNGSVNSMHDSYTPLGGMVPLAHMMLGEVSPGGTGVGLNGLLVMAI
LAVFIAGLMVGRTPEYLGKKIQATEMKLVTLYILAMPIALLSFAAASVLISSALASRNNPGPHGLSEILYAYTSGANNNGSAFAGLTASTWSYDTTIGVA
MLIGRFFLIIPVLAIAGSLARKGTTPVTAATFPTHKPLFVGLVIGVVLIVGGLTFFPALALGPIVEQLSTQ

Additional Information