TB Genome Annotation Portal

Rv0986 (-)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: ABC transporter ATP-binding protein
  • REFSEQ: adhesion component transport ATP-binding protein ABC transporter
  • PATRIC: AttE component of AttEFGH ABC transport system
  • TUBERCULIST: Probable adhesion component transport ATP-binding protein ABC transporter
  • NCBI: Probable adhesion component transport ATP-binding protein ABC transporter
  • updated information (H37Rv4):
    • gene name: -
    • function: ABC-transporter; implicated in preventing acidification and phagosome maturation
    • reference: Pethe (2004) PMID: 15340136
• Type: Not Target
• Start: 1101803
• End: 1102549
• Operon:


• Trans-membrane region:
  
• Role: II.C.5 - Other membrane proteins
• GO terms:
  • GO:0052572 - response to host immune response (Uniprot)
  • GO:0016887 - ATPase activity (Uniprot)
  • GO:0009405 - pathogenesis (Uniprot)
  • GO:0005524 - ATP binding (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  5XU1	42%	Streptococcus pneumoniae (strain ATCC BAA-255 / R6)	Structure of a non-canonical ABC transporter from Streptococcus pneumoniae R6
  4U02	42%	Thermus thermophilus HB8	Crystal structure of apo-TTHA1159
  4U00	42%	Thermus thermophilus HB8	Crystal structure of TTHA1159 in complex with ADP
  1F3O	42%	Methanocaldococcus jannaschii	Crystal structure of MJ0796 ATP-binding cassette
  3TIF	42%	Methanocaldococcus jannaschii DSM 2661	Dimeric structure of a post-hydrolysis state of the ATP-binding cassette MJ0796 bound to ADP and Pi
  1L2T	42%	Methanocaldococcus jannaschii	Dimeric Structure of MJ0796, a Bacterial ABC Transporter Cassette
  4YMW	41%	Caldanaerobacter subterraneus subsp. tengcongensis MB4	Crystal structure of an amino acid ABC transporter with histidines
  4YMV	41%	Caldanaerobacter subterraneus subsp. tengcongensis MB4	Crystal structure of an amino acid ABC transporter with ATPs
  4YMU	41%	Caldanaerobacter subterraneus subsp. tengcongensis MB4	Crystal structure of an amino acid ABC transporter complex with arginines and ATPs
  4YMT	41%	Caldanaerobacter subterraneus subsp. tengcongensis MB4	Crystal structure of an amino acid ABC transporter complex with arginines

• Links to additional information on Rv0986:
  • Mycobrowser
  • PATRIC
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 1.022 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MNRQPIVQLSNLSWTFREGETRRQVLDHITFDFEPGEFVALLGQSGSGKSTLLNLISGIEKPTTGDVTINGFAITQKTERDRTLFRRDQIGIVFQFFNLI
PTLTVLENITLPQELAGVSQRKAAVVARDLLEKVGMADRERTFPDKLSGGEQQRVAISRALAHNPMLVLADEPTGNLDSDTGDKVLDVLLDLTRQAGKTL
IMATHSPSMTQHADRVVNLQGGRLIPAVNRENQTDQPASTILLPTSYE

Additional Information

essential in vitro and in vivo; phenotype with respect to survival of vacuole acidification
Pethe: http://www.ncbi.nlm.nih.gov/pubmed/15340136

Analysis of Positive Selection in Clinical Isolates *new*

• Analysis of dN/dS (omega) in two collections of Mtb clinical isolates using GenomegaMap (Window model) (see description of methods)
  • Moldova: 2,057 clinical isolates
  • global set: 5,195 clinical isolates from 15 other countries
• In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
• A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.

	Moldova (2,057)	global set (5,195)
under significant positive selection?	NO	NO
omega peak height (95%CI lower bound)	1.57 (0.43)	1.1 (0.51)
codons under selection
omega plots
genetic variants*	link	link
statistics at each codon	link	link