TB Genome Annotation Portal

Rv0980c (PE_PGRS18)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: 40-residue YVTN family beta-propeller
  • REFSEQ: PE-PGRS family protein
  • PATRIC: PE_PGRS family protein
  • TUBERCULIST: PE-PGRS family protein PE_PGRS18
  • NCBI: PE-PGRS family protein PE_PGRS18
  • updated information (H37Rv4):
    • gene name: PE_PGRS18
    • function:
    • reference:
• Type: Not Target
• Start: 1095078
• End: 1096451
• Operon:


• Trans-membrane region:
  
• Role: IV.C.1.b - PE_PGRS subfamily
• GO terms:
  • No terms assigned.
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  1L0Q	49%	Methanosarcina mazei	Tandem YVTN beta-propeller and PKD domains from an archaeal surface layer protein
  5XFS	43%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Crystal structure of PE8-PPE15 in complex with EspG5 from M. tuberculosis
  5I1Z	43%	synthetic construct	Structure of nvPizza2-H16S58
  5I1Y	43%	synthetic construct	NvPizza2-H16S58 with cobalt
  6REM	40%	synthetic construct	Crystal structure of Pizza6-SH with Sulphate ion
  6REL	40%	synthetic construct	Crystal structure of Pizza6-SH with CdCl2 nanocrystal
  6REK	40%	synthetic construct	Crystal structure of Pizza6-SH with Cu2+
  6REJ	40%	synthetic construct	Crystal structure of Pizza6-SH with Zn2+
  6REN	40%	synthetic construct	Crystal structure of 3fPizza6-SH with Zn2+
  6REI	40%	synthetic construct	Crystal structure of Pizza6-S with Cd2+

• Links to additional information on PE_PGRS18:
  • Mycobrowser
  • PATRIC
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.269 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MSFVNVAPQLVSTAAADAARIGSAINTANTAAAATTQVLAAAHDEVSTAIAALFGSHGQHYQAISAQVAAYQERFVLALSQASSTYAVAEAASATPLQNV
LDAINAPVQSLTGRPLIGDGANGIDGTGQAGGNGGWLWGNGGNGGSGAPGQAGGAGGAAGLIGNGGAGGAGGQGLPFEAGANGGAGGAGGWLFGNGGAGG
VGGAGGAGTTFGVAGGDGGTGGVGGHGGLIGVGGHGGDGGTGGTGGAVSLARAGTAGGAGGGPAGGIGGAGGVGGAGGAAGAVTTITHASFNDPHGVAVN
PGGNIYVTNQGSNTVSVIDPVTNTVTGSITDGNGPSGVAVSPVTGLVFVTNFDSNTVSVIDPNTNTVTGSIPVGTGAYGVAVNPGGNIYVTNQFSNTVSV
IDPATNTVTGSPIPVGLDPTGVAVNPVTGVVYVTNSLDDTVSVITGEPARSVCSAAI

Additional Information