TB Genome Annotation Portal

Rv0967 (csoR)

Amino Acid Sequence

MSKELTAKKRAALNRLKTVRGHLDGIVRMLESDAYCVDVMKQISAVQSSLERANRVMLHNHLETCFSTAVLDGHGQAAIEELIDAVKFTPALTGPHARLG
GAAVGESATEEPMPDASNM
(Nucleotide sequence available on KEGG)

Additional Information


















    ESSENTIALITY 

    







    



MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb


TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*



        

        
 Classification Condition Strain Method Reference Notes 


            

                Too-Short
                Sodium Oleate
                H37RvMA

                    Gumbel



                    Subhalaxmi Nambi


                Probability of Essentiality: -1.000000;
0 non-insertions in a row out of 1 sites		
            



            

                Too-Short
                Lignoceric Acid
                H37RvMA

                    Gumbel



                    Subhalaxmi Nambi


                Probability of Essentiality: -1.000000;
0 non-insertions in a row out of 1 sites		
            



            

                Too-Short
                Phosphatidylcholine
                H37RvMA

                    Gumbel



                    Subhalaxmi Nambi


                Probability of Essentiality: -1.000000;
0 non-insertions in a row out of 1 sites		
            



            

                Too-Short
                minimal media + 0.1% glycerol
                H37RvMA

                    Gumbel



                    Griffin et al. (2011)


                Probability of Essentiality: -1.000000;
0 non-insertions in a row out of 1 sites		
            



            

                Too-Short
                minimal media + 0.01% cholesterol
                H37RvMA

                    Gumbel



                    Griffin et al. (2011)


                Probability of Essentiality: -1.000000;
0 non-insertions in a row out of 1 sites		
            



            

                No-Data
                7H10-glycerol
                H37RvMA

                    TraSH



                    Sassetti et al. (2003a)


                 
            



            

                Too-Short
                C57BL/6J mice (8 weeks)
                H37RvMA

                    TraSH



                    Sassetti et al. (2003b)


                Hybridization Ratio: -1
            



            

                Uncertain
                7H09/7H10 + rich media
                H37RvMA

                    MotifHMM



                    DeJesus et al. (2017)


                Fully saturated (14 reps).
            



        



    












 





    TnSeq Data    No data currently available.

    




    



        
  •  No TnSeq data currently available for this Target.



















    RNASeq Data   No data currently available.

    





    



        
  •  No RNA-Seq data currently available for this Target.




















    Metabolomic Profiles    No data currently available.

    





    




        
  •  No Metabolomic data currently available for this Target.




















    Proteomic Data   No data currently available. 

    






    



        
  •  No Proteomic data currently available for this Target.


















 





    Regulatory Relationships from Systems Biology 

    




    






                
  • BioCyc


    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)
    

    NOTE: 
    Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.




    Interactions based on ChIPSeq data
    

    
    

    
    
    

    • 






    Interactions based on ChIPSeq data (Minch et al. 2014)
    




    Interactions based on TFOE data (Rustad et al. 2014)
    














    

    






    


    


    


    TBCAP
    
Tubculosis Community Annotation Project (    Slayden et al., 2013)
    
Rv0967 (csoR)

    

    PropertyValueCreatorEvidencePMIDComment
    
InteractionRegulatory Rv0970raj252000RCACo-expression (Functional linkage)
    PC. Karakousis, T. Yoshimatsu et al. Dormancy phenotype displayed by extracellular Mycobacterium tuberculosis within artificial granulomas in mice. J. Exp. Med. 2004
    
InteractionRegulatory Rv0970raj252000RCACo-expression (Functional linkage)
    AM. Talaat, SK. Ward et al. Mycobacterial bacilli are metabolically active during chronic tuberculosis in murine lungs: insights from genome-wide transcriptional profiling. J. Bacteriol. 2007
    
InteractionRegulatory Rv0970raj252000RCACo-expression (Functional linkage)
    authors,AM. Talaat,R. Lyons,ST. Howard,SA. Johnston The temporal expression profile of Mycobacterium tuberculosis infection in mice. Proc. Natl. Acad. Sci. U.S.A. 2004
    
InteractionRegulatory Rv0757singhpankaj2116IEPCo-expression (Functional linkage)
    ML. Chesne-Seck, N. Barilone et al. A point mutation in the two-component regulator PhoP-PhoR accounts for the absence of polyketide-derived acyltrehaloses but not that of phthiocerol dimycocerosates in Mycobacterium tuberculosis H37Ra. J. Bacteriol. 2008
    
InteractionRegulatory Rv0757singhpankaj2116IEPCo-expression (Functional linkage)
    authors,A. Sola-Landa,RS. Moura,JF. Martn The two-component PhoR-PhoP system controls both primary metabolism and secondary metabolite biosynthesis in Streptomyces lividans. Proc. Natl. Acad. Sci. U.S.A. 2003
    
InteractionRegulatory Rv0757singhpankaj2116IEPCo-expression (Functional linkage)
    J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
    
InteractionRegulatory Rv0757singhpankaj2116IEPCo-expression (Functional linkage)
    J. Gonzalo-Asensio, CY. Soto et al. The Mycobacterium tuberculosis phoPR operon is positively autoregulated in the virulent strain H37Rv. J. Bacteriol. 2008
    
InteractionRegulatory Rv0757singhpankaj2116IEPCo-expression (Functional linkage)
    A. Sinha, S. Gupta et al. PhoP-PhoP interaction at adjacent PhoP binding sites is influenced by protein phosphorylation. J. Bacteriol. 2008
    
InteractionRegulatory Rv0757singhpankaj2116IEPCo-expression (Functional linkage)
    J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
    
InteractionRegulatory Rv0757singhpankaj2116IEPCo-expression (Functional linkage)
    M. Ryndak, S. Wang et al. PhoP, a key player in Mycobacterium tuberculosis virulence. Trends Microbiol. 2008
    
InteractionRegulatory Rv0757singhpankaj2116IEPCo-expression (Functional linkage)
    JA. Asensio, A. Arbus et al. Live tuberculosis vaccines based on phoP mutants: a step towards clinical trials. Expert opinion on biological therapy 2008
    
InteractionRegulatory Rv0757singhpankaj2116IEPCo-expression (Functional linkage)
    SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
    
InteractionRegulatory Rv0757singhpankaj2116IEPCo-expression (Functional linkage)
    J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008
    
InteractionRegulatedBy Rv0348yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type  and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
    
InteractionRegulatedBy Rv0757yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type  and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
    
CitationCsoR is a novel Mycobacterium tuberculosis copper-sensing transcriptional regulator. authors,T. Liu,A. Ramesh,Z. Ma,SK. Ward,L. Zhang,GN. George,AM. Talaat,JC. Sacchettini,DP. Giedroc Nat. Chem. Biol. 2007yamir.morenoIEP17143269qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type  and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
    
InteractionRegulates Rv0970yamir.morenoIEPqRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type  and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
    authors,T. Liu,A. Ramesh,Z. Ma,SK. Ward,L. Zhang,GN. George,AM. Talaat,JC. Sacchettini,DP. Giedroc CsoR is a novel Mycobacterium tuberculosis copper-sensing transcriptional regulator. Nat. Chem. Biol. 2007
    
InteractionRegulatedBy Rv0967yamir.morenoIEPqRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type  and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    authors,T. Liu,A. Ramesh,Z. Ma,SK. Ward,L. Zhang,GN. George,AM. Talaat,JC. Sacchettini,DP. Giedroc CsoR is a novel Mycobacterium tuberculosis copper-sensing transcriptional regulator. Nat. Chem. Biol. 2007
    
CitationCsoR is a novel Mycobacterium tuberculosis copper-sensing transcriptional regulator. authors,T. Liu,A. Ramesh,Z. Ma,SK. Ward,L. Zhang,GN. George,AM. Talaat,JC. Sacchettini,DP. Giedroc Nat. Chem. Biol. 2007yamir.morenoIDA17143269qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type  and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    
InteractionRegulates Rv0967yamir.morenoIDAqRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type  and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    authors,T. Liu,A. Ramesh,Z. Ma,SK. Ward,L. Zhang,GN. George,AM. Talaat,JC. Sacchettini,DP. Giedroc CsoR is a novel Mycobacterium tuberculosis copper-sensing transcriptional regulator. Nat. Chem. Biol. 2007
    
InteractionRegulatedBy Rv0967yamir.morenoIDAqRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type  and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    authors,T. Liu,A. Ramesh,Z. Ma,SK. Ward,L. Zhang,GN. George,AM. Talaat,JC. Sacchettini,DP. Giedroc CsoR is a novel Mycobacterium tuberculosis copper-sensing transcriptional regulator. Nat. Chem. Biol. 2007
    
CitationCsoR is a novel Mycobacterium tuberculosis copper-sensing transcriptional regulator. authors,T. Liu,A. Ramesh,Z. Ma,SK. Ward,L. Zhang,GN. George,AM. Talaat,JC. Sacchettini,DP. Giedroc Nat. Chem. Biol. 2007yamir.morenoIEP17143269qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type  and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
    
InteractionRegulates Rv0968yamir.morenoIEPqRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type  and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
    authors,T. Liu,A. Ramesh,Z. Ma,SK. Ward,L. Zhang,GN. George,AM. Talaat,JC. Sacchettini,DP. Giedroc CsoR is a novel Mycobacterium tuberculosis copper-sensing transcriptional regulator. Nat. Chem. Biol. 2007
    
CitationCsoR is a novel Mycobacterium tuberculosis copper-sensing transcriptional regulator. authors,T. Liu,A. Ramesh,Z. Ma,SK. Ward,L. Zhang,GN. George,AM. Talaat,JC. Sacchettini,DP. Giedroc Nat. Chem. Biol. 2007yamir.morenoIEP17143269qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type  and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
    
InteractionRegulates Rv0969yamir.morenoIEPqRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type  and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
    authors,T. Liu,A. Ramesh,Z. Ma,SK. Ward,L. Zhang,GN. George,AM. Talaat,JC. Sacchettini,DP. Giedroc CsoR is a novel Mycobacterium tuberculosis copper-sensing transcriptional regulator. Nat. Chem. Biol. 2007
    
CitationCsoR is a novel Mycobacterium tuberculosis copper-sensing transcriptional regulator. authors,T. Liu,A. Ramesh,Z. Ma,SK. Ward,L. Zhang,GN. George,AM. Talaat,JC. Sacchettini,DP. Giedroc Nat. Chem. Biol. 2007yamir.morenoIEP17143269qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type  and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    
InteractionRegulates Rv0967yamir.morenoIEPqRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type  and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    authors,T. Liu,A. Ramesh,Z. Ma,SK. Ward,L. Zhang,GN. George,AM. Talaat,JC. Sacchettini,DP. Giedroc CsoR is a novel Mycobacterium tuberculosis copper-sensing transcriptional regulator. Nat. Chem. Biol. 2007
    
InteractionRegulates Rv0968yamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    
CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    
InteractionRegulates Rv0969yamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    
CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    
InteractionRegulates Rv0967yamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    
InteractionRegulatedBy Rv0967yamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    
CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    

    


    Comments