Rv0946c (pgi)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: glucose-6-phosphate isomerase
- REFSEQ: glucose-6-phosphate isomerase
- PATRIC: Glucose-6-phosphate isomerase (EC 5.3.1.9)
- TUBERCULIST: Probable glucose-6-phosphate isomerase Pgi (GPI) (phosphoglucose isomerase) (phosphohexose isomerase) (phi)
- NCBI: Probable glucose-6-phosphate isomerase Pgi (GPI) (phosphoglucose isomerase) (phosphohexose isomerase) (phi)
- updated information (H37Rv4):
  - gene name: pgi
  - function:
  - reference:
Type: Not Target
Start: 1055024
End: 1056685
Operon:

Trans-membrane region:
Role: I.B.1 - Glycolysis
GO terms:
- GO:0040007 - growth (Uniprot)
- GO:0016853 - isomerase activity (Uniprot)
- GO:0006096 - glycolytic process (Uniprot)
- GO:0006094 - gluconeogenesis (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
- GO:0005737 - cytoplasm (Uniprot)
- GO:0004347 - glucose-6-phosphate isomerase activity (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure: 2wu8
Search for Homologs in PDB

Top 10 Homologs in PDB (as of Nov 2020):

PDB	aa ident	species	PDB title
2WU8	99%	MYCOBACTERIUM TUBERCULOSIS	Structural studies of phosphoglucose isomerase from Mycobacterium tuberculosis H37Rv
4EM6	53%	Brucella melitensis bv. 1	The structure of Glucose-6-phosphate isomerase (GPI) from Brucella melitensis
3HJB	51%	Vibrio cholerae	1.5 Angstrom Crystal Structure of Glucose-6-phosphate Isomerase from Vibrio cholerae.
3NBU	51%	Escherichia coli	Crystal structure of pGI glucosephosphate isomerase
4WMJ	49%	Colias eurytheme	Colias eurytheme Phosphoglucose isomerase. Homodimer from 4-5(18) genotype.
1XTB	49%	Oryctolagus cuniculus	Crystal Structure of Rabbit Phosphoglucose Isomerase Complexed with Sorbitol-6-Phosphate
1N8T	49%	Oryctolagus cuniculus	The crystal structure of phosphoglucose isomerase from rabbit muscle
1KOJ	49%	Oryctolagus cuniculus	Crystal structure of rabbit phosphoglucose isomerase complexed with 5-phospho-D-arabinonohydroxamic acid
1HOX	49%	Oryctolagus cuniculus	CRYSTAL STRUCTURE OF RABBIT PHOSPHOGLUCOSE ISOMERASE COMPLEXED WITH FRUCTOSE-6-PHOSPHATE
1HM5	49%	Oryctolagus cuniculus	CRYSTAL STRUCTURE ANALYSIS OF THE RABBIT D-GLUCOSE 6-PHOSPHATE ISOMERASE (NO LIGAND BOUND)

Links to additional information on pgi:
- TBDB (updated)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

MTSAPIPDITATPAWDALRRHHDQIGNTHLRQFFADDPGRGRELTVSVGDLYIDYSKHRVTRETLALLIDLARTAHLEERRDQMFAGVHINTSEDRAVLH
TALRLPRDAELVVDGQDVVTDVHAVLDAMGAFTDRLRSGEWTGATGKRISTVVNIGIGGSDLGPVMVYQALRHYADAGISARFVSNVDPADLIATLADLD
PATTLFIVASKTFSTLETLTNATAARRWLTDALGDAAVSRHFVAVSTNKRLVDDFGINTDNMFGFWDWVGGRYSVDSAIGLSLMTVIGRDAFADFLAGFH
IIDRHFATAPLESNAPVLLGLIGLWYSNFFGAQSRTVLPYSNDLSRFPAYLQQLTMESNGKSTRADGSPVSADTGEIFWGEPGTNGQHAFYQLLHQGTRL
VPADFIGFAQPLDDLPTAEGTGSMHDLLMSNFFAQTQVLAFGKTAEEIAADGTPAHVVAHKVMPGNRPSTSILASRLTPSVLGQLIALYEHQVFTEGVVW
GIDSFDQWGVELGKTQAKALLPVITGAGSPPPQSDSSTDGLVRRYRTERGRAG

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 1.000000; 19 non-insertions in a row out of 19 sites
Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 1.000000; 18 non-insertions in a row out of 19 sites
Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 1.000000; 19 non-insertions in a row out of 19 sites
Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 1.000000; 19 non-insertions in a row out of 20 sites
Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 1.000000; 19 non-insertions in a row out of 20 sites
Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 0.06
Growth-Defect	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0576 (-)

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- No bindings to other targets were found.

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Not upregulated by other genes.
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Rv0576 (-)

Property	Value	Creator	Evidence	PMID	Comment
Citation	Biochemical characterization of recombinant phosphoglucose isomerase of Mycobacterium tuberculosis. D. Mathur, Z. Ahsan et al. Biochem. Biophys. Res. Commun. 2005	njamshidi	IDA	16212940	see PMID: 16212940
Term	EC:5.3.1.9 Glucose-6-phosphate isomerase. - IDA	njamshidi	IDA	16212940	see PMID: 16212940 D. Mathur, Z. Ahsan et al. Biochemical characterization of recombinant phosphoglucose isomerase of Mycobacterium tuberculosis. Biochem. Biophys. Res. Commun. 2005
Term	TBRXN:PGI glucose-6-phosphate isomerase - IDA	njamshidi	IDA	16212940	see PMID: 16212940 D. Mathur, Z. Ahsan et al. Biochemical characterization of recombinant phosphoglucose isomerase of Mycobacterium tuberculosis. Biochem. Biophys. Res. Commun. 2005
Citation	Biochemical characterization of recombinant phosphoglucose isomerase of Mycobacterium tuberculosis. D. Mathur, Z. Ahsan et al. Biochem. Biophys. Res. Commun. 2005	njamshidi	ISS	16212940	see PMID: 16212940
Term	EC:5.3.1.9 Glucose-6-phosphate isomerase. - ISS	njamshidi	ISS	16212940	see PMID: 16212940 D. Mathur, Z. Ahsan et al. Biochemical characterization of recombinant phosphoglucose isomerase of Mycobacterium tuberculosis. Biochem. Biophys. Res. Commun. 2005
Term	TBRXN:PGI glucose-6-phosphate isomerase - ISS	njamshidi	ISS	16212940	see PMID: 16212940 D. Mathur, Z. Ahsan et al. Biochemical characterization of recombinant phosphoglucose isomerase of Mycobacterium tuberculosis. Biochem. Biophys. Res. Commun. 2005
Citation	Central carbon metabolism in Mycobacterium tuberculosis: an unexpected frontier. authors,KY. Rhee,LP. de Carvalho,R. Bryk,S. Ehrt,J. Marrero,SW. Park,D. Schnappinger,A. Venugopal,C. Nathan Trends Microbiol. 2011	extern:JZUCKER		21561773	Traceable author statement to experimental support
Term	EC:5.3.1.9 Glucose-6-phosphate isomerase. - NR	extern:JZUCKER	NR		Traceable author statement to experimental support authors,KY. Rhee,LP. de Carvalho,R. Bryk,S. Ehrt,J. Marrero,SW. Park,D. Schnappinger,A. Venugopal,C. Nathan Central carbon metabolism in Mycobacterium tuberculosis: an unexpected frontier. Trends Microbiol. 2011
Citation	Structural studies of phosphoglucose isomerase from Mycobacterium tuberculosis H37Rv. K. Anand, D. Mathur et al. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2010	extern:JZUCKER		20445242	Inferred from mutant phenotype
Term	EC:5.3.1.9 Glucose-6-phosphate isomerase. - NR	extern:JZUCKER	NR		Inferred from mutant phenotype K. Anand, D. Mathur et al. Structural studies of phosphoglucose isomerase from Mycobacterium tuberculosis H37Rv. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2010

TB Genome Annotation Portal