Rv0901 (-)
Current annotations:
TBCAP: (community-based annotations - see table at bottom of page )
TBDB: hypothetical protein
REFSEQ: hypothetical protein
PATRIC: POSSIBLE CONSERVED EXPORTED OR MEMBRANE PROTEIN
TUBERCULIST: Possible conserved exported or membrane protein
NCBI: Possible conserved exported or membrane protein
updated information (H37Rv4):
gene name: -
function:
reference:
Coordinates in H37Rv: 1003957 - 1004484
Gene length: 528 bp (with stop codon), 175 aa (without stop codon)
Operon:
Trans-membrane region:
Role: V - Conserved hypotheticals
GO terms:
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Latest Homologs in PDB
Top 10 Homologs in PDB (as of Apr 2026): (none with >35% aa id)
Links to additional information on Rv0901:
Amino Acid Sequence
MEHVHWWLAGLAFTLGMVLTSTLMVRPVEHQVLVKKSVRGSSAKSKPPTARKPAVKSGTKREESPTAKTKVATESAAEQIPVAGEPAAEPIPVAGEPAAR
IPVVPYAPYGPGSARAGADGSGPQGWLVKGRSDTRLYYTPEDPTYDPTVAQVWFQDEESAARAFFTPWRKSTRRT
(
Nucleotide sequence available on
KEGG )
Additional Information
MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb
TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions
Rv0901/-,
gene len: 527 bp, num TA sites: 9
condition dataset call medium method notes
in-vitro DeJesus 2017 mBio non-essential 7H9 HMM fully saturated, 14 TnSeq libraries combined
in-vitro Sassetti 2003 Mol Micro non-essential 7H9 TRASH essential if hybridization ratio<0.2
in-vivo (mice) Sassetti 2003 PNAS non-essential BL6 mice TRASH essential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol) Griffin 2011 PPath non-essential M9 minimal+glycerol Gumbel 2 replicates; Padj<0.05
in-vitro (cholesterol) Griffin 2011 PPath non-essential M9 minimal+cholesterol Gumbel 3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPath NO (LFC=-0.6) cholesterol vs glycerol resampling-SR YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitro Smith 2022 eLife non-essential 7H9 HMM 6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice) Smith 2022 eLife non-essential BL6 mice HMM 6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in mice Smith 2022 eLife NO (LFC=0.138) in-vivo vs in-vitro ZINB YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal) Minato 2019 mSys non-essential minimal medium HMM
in-vitro (YM rich medium) Minato 2019 mSys non-essential YM rich medium HMM 7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich medium Minato 2019 mSys NO (LFC=-1.81) YM rich vs minimal medium resampling
Analysis of Positive Selection in Clinical Isolates
*new*
data from Culviner et al (2025) (55,259 Mtb clinical isolates)
overall pN/pS for Rv0901: 1.027129309
lineage-specific pN/pS in L1: 0.995031518
lineage-specific pN/pS in L2: 1.848832757
lineage-specific pN/pS in L3: 1.011080414
lineage-specific pN/pS in L4: 0.888861902
Analysis of dN/dS (omega) in a global collection of 10k Mtb clinical isolates using GenomegaMap (Window model)
clinical isolates collection: global set of 10,626 Mtb genomes
In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.
global set of 10,626 Mtb clinical isolates
under significant positive selection? YES
omega peak height (95%CI lower bound) 2.02 (1.02)
codons under selection 119, 120, 121
omega plots
genetic variants* link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"
TnSeq Data No data currently available.
No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
No Proteomic data currently available for this Target.
Regulatory Relationships from Systems Biology
BioCyc
Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology )
NOTE:
see table of TFOE interactions below
Interactions based on ChIPSeq data
RNA processing and modification
Energy production and conversion
Chromatin structure and dynamics
Amino acid transport and metabolism
Cell cycle control, cell division, chromosome partitioning
Carbohydrate transport and metabolism
Nucleotide transport and metabolism
Lipid transport and metabolism
Coenzyme transport and metabolism
Translation, ribosomal structure and biogenesis
Cell wall/membrane/envelope biogenesis
Replication, recombination and repair
Posttranslational modification, protein turnover, chaperones
Secondary metabolites biosynthesis, transport and catabolism
Inorganic ion transport and metabolism
General function prediction only
Intracellular trafficking, secretion, and vesicular transport
Signal transduction mechanisms
Differentially expressed as result of RNASeq in glycerol environment (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
Conditionally essential as result of TNSeq (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
Binds To:
No bindings to other targets were found.
Bound By:
No bindings from other targets were found.
Binds To:
No bindings to other targets were found.
Bound By:
No bindings to other targets were found.
TFOE = Transcription Factor Over-Expression study
significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01
no significant interactions found
Upregulates:
Does not upregulate other genes.
Upregulated by:
Not upregulated by other genes.
Downregulates:
Does not downregulate other genes.
Downregulated by:
Not downregulated by other genes.
Property Value Creator Evidence PMID Comment
Interaction PhysicalInteraction Rv0900 shahanup86 NAS Operon (Functional linkage)L. Zhang, Q. Zhong et al. Rv0901 from Mycobacterium tuberculosis, a possible novel virulent gene proved through the recombinant Mycobacterium smegmatis. Jpn. J. Infect. Dis. 2009
Interaction PhysicalInteraction Rv0899 shahanup86 NAS Operon (Functional linkage)L. Zhang, Q. Zhong et al. Rv0901 from Mycobacterium tuberculosis, a possible novel virulent gene proved through the recombinant Mycobacterium smegmatis. Jpn. J. Infect. Dis. 2009
Citation [Effect of transfected Rv0901 gene on the activity of mice macrophages] Q. Zhong, L. Bao et al. Sichuan Da Xue Xue Bao Yi Xue Ban 2007 shahanup86 NAS 17441335 Operon (Functional linkage)
Interaction PhysicalInteraction Rv0900 shahanup86 NAS Operon (Functional linkage)Q. Zhong, L. Bao et al. [Effect of transfected Rv0901 gene on the activity of mice macrophages] Sichuan Da Xue Xue Bao Yi Xue Ban 2007
Interaction PhysicalInteraction Rv0899 shahanup86 NAS Operon (Functional linkage)Q. Zhong, L. Bao et al. [Effect of transfected Rv0901 gene on the activity of mice macrophages] Sichuan Da Xue Xue Bao Yi Xue Ban 2007
Interaction PhysicalInteraction Rv0900 shahanup86 NAS Operon (Functional linkage)authors,CM. Sassetti,DH. Boyd,EJ. Rubin Genes required for mycobacterial growth defined by high density mutagenesis. Mol. Microbiol. 2003
Interaction PhysicalInteraction Rv0899 shahanup86 NAS Operon (Functional linkage)authors,CM. Sassetti,DH. Boyd,EJ. Rubin Genes required for mycobacterial growth defined by high density mutagenesis. Mol. Microbiol. 2003
Citation Mycobacterium tuberculosis Rv0899 adopts a mixed alpha/beta-structure and does not form a transmembrane beta-barrel. P. Teriete,Y. Yao,A. Kolodzik,J. Yu,H. Song,M. Niederweis,FM. Marassi Biochemistry 2010 shahanup86 NAS 20199110 Operon (Functional linkage)
Interaction PhysicalInteraction Rv0900 shahanup86 NAS Operon (Functional linkage)P. Teriete,Y. Yao,A. Kolodzik,J. Yu,H. Song,M. Niederweis,FM. Marassi Mycobacterium tuberculosis Rv0899 adopts a mixed alpha/beta-structure and does not form a transmembrane beta-barrel. Biochemistry 2010
Interaction PhysicalInteraction Rv0899 shahanup86 NAS Operon (Functional linkage)P. Teriete,Y. Yao,A. Kolodzik,J. Yu,H. Song,M. Niederweis,FM. Marassi Mycobacterium tuberculosis Rv0899 adopts a mixed alpha/beta-structure and does not form a transmembrane beta-barrel. Biochemistry 2010
Citation A novel IS element, ISMpa1, in Mycobacterium avium subsp. paratuberculosis. I. Olsen, TB. Johansen et al. Vet. Microbiol. 2004 shahanup86 NAS 15036538 Operon (Functional linkage)
Interaction PhysicalInteraction Rv0900 shahanup86 NAS Operon (Functional linkage)I. Olsen, TB. Johansen et al. A novel IS element, ISMpa1, in Mycobacterium avium subsp. paratuberculosis. Vet. Microbiol. 2004
Interaction PhysicalInteraction Rv0899 shahanup86 NAS Operon (Functional linkage)I. Olsen, TB. Johansen et al. A novel IS element, ISMpa1, in Mycobacterium avium subsp. paratuberculosis. Vet. Microbiol. 2004
Citation Rv0901 from Mycobacterium tuberculosis, a possible novel virulent gene proved through the recombinant Mycobacterium smegmatis. L. Zhang, Q. Zhong et al. Jpn. J. Infect. Dis. 2009 shahanup86 NAS 19168955 Operon (Functional linkage)
Interaction PhysicalInteraction Rv0899 shahanup86 NAS Operon (Functional linkage)I. Schiller, HM. Vordermeier et al. Assessment of Mycobacterium tuberculosis OmpATb as a novel antigen for the diagnosis of bovine tuberculosis. Clin. Vaccine Immunol. 2009
Interaction PhysicalInteraction Rv0900 shahanup86 NAS Operon (Functional linkage)P. Teriete,Y. Yao,A. Kolodzik,J. Yu,H. Song,M. Niederweis,FM. Marassi Mycobacterium tuberculosis Rv0899 adopts a mixed alpha/beta-structure and does not form a transmembrane beta-barrel. Biochemistry 2010
Interaction PhysicalInteraction Rv0900 shahanup86 NAS Operon (Functional linkage)I. Olsen, TB. Johansen et al. A novel IS element, ISMpa1, in Mycobacterium avium subsp. paratuberculosis. Vet. Microbiol. 2004
Citation Genes required for mycobacterial growth defined by high density mutagenesis. authors,CM. Sassetti,DH. Boyd,EJ. Rubin Mol. Microbiol. 2003 shahanup86 NAS 12657046 Operon (Functional linkage)
Interaction PhysicalInteraction Rv0899 shahanup86 NAS Operon (Functional linkage)H. Song, R. Sandie et al. Identification of outer membrane proteins of Mycobacterium tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008
Interaction PhysicalInteraction Rv0899 shahanup86 NAS Operon (Functional linkage)P. Teriete,Y. Yao,A. Kolodzik,J. Yu,H. Song,M. Niederweis,FM. Marassi Mycobacterium tuberculosis Rv0899 adopts a mixed alpha/beta-structure and does not form a transmembrane beta-barrel. Biochemistry 2010
Interaction PhysicalInteraction Rv0899 shahanup86 NAS Operon (Functional linkage)authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null