TB Genome Annotation Portal

Rv0899 (ompA)

Amino Acid Sequence

VASKAGLGQTPATTDARRTQKFYRGSPGRPWLIGAVVIPLLIAAIGYGAFERPQSVTGPTGVLPTLTPTSTRGASALSLSLLSISRSGNTVTLIGDFPDE
AAKAALMTALNGLLAPGVNVIDQIHVDPVVRSLDFSSAEPVFTASVPIPDFGLKVERDTVTLTGTAPSSEHKDAVKRAATSTWPDMKIVNNIEVTGQAPP
GPPASGPCADLQSAINAVTGGPIAFGNDGASLIPADYEILNRVADKLKACPDARVTINGYTDNTGSEGINIPLSAQRAKIVADYLVARGVAGDHIATVGL
GSVNPIASNATPEGRAKNRRVEIVVN
(Nucleotide sequence available on KEGG)

Additional Information




Analysis of Positive Selection in Clinical Isolates *new*

Moldova (2,057)global set (5,195)
under significant positive selection?NONO
omega peak height (95%CI lower bound)1.5 (0.19)1.86 (0.77)
codons under selection
omega plots
genetic variantslinklink
statistics at each codonlinklink

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Non-Essential Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
5 non-insertions in a row out of 19 sites
Non-Essential Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.026700;
2 non-insertions in a row out of 19 sites
Non-Essential Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 19 sites
Uncertain minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.685300;
6 non-insertions in a row out of 20 sites
Essential minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.998200;
11 non-insertions in a row out of 20 sites
No-Data 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Too-Short C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: -1
Non-Essential 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

      • No bindings to other targets were found.

    Interactions based on TFOE data (Rustad et al. 2014)



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv0899 (ompA)

    PropertyValueCreatorEvidencePMIDComment
    InteractionPhysicalInteraction Rv0901shahanup86NASOperon (Functional linkage)
    L. Zhang, Q. Zhong et al. Rv0901 from Mycobacterium tuberculosis, a possible novel virulent gene proved through the recombinant Mycobacterium smegmatis. Jpn. J. Infect. Dis. 2009
    InteractionPhysicalInteraction Rv0901shahanup86NASOperon (Functional linkage)
    Q. Zhong, L. Bao et al. [Effect of transfected Rv0901 gene on the activity of mice macrophages] Sichuan Da Xue Xue Bao Yi Xue Ban 2007
    InteractionPhysicalInteraction Rv0901shahanup86NASOperon (Functional linkage)
    authors,CM. Sassetti,DH. Boyd,EJ. Rubin Genes required for mycobacterial growth defined by high density mutagenesis. Mol. Microbiol. 2003
    InteractionPhysicalInteraction Rv0901shahanup86NASOperon (Functional linkage)
    P. Teriete,Y. Yao,A. Kolodzik,J. Yu,H. Song,M. Niederweis,FM. Marassi Mycobacterium tuberculosis Rv0899 adopts a mixed alpha/beta-structure and does not form a transmembrane beta-barrel. Biochemistry 2010
    InteractionPhysicalInteraction Rv0901shahanup86NASOperon (Functional linkage)
    I. Olsen, TB. Johansen et al. A novel IS element, ISMpa1, in Mycobacterium avium subsp. paratuberculosis. Vet. Microbiol. 2004
    InteractionPhysicalInteraction Rv0900shahanup86NASOperon (Functional linkage)
    I. Schiller, HM. Vordermeier et al. Assessment of Mycobacterium tuberculosis OmpATb as a novel antigen for the diagnosis of bovine tuberculosis. Clin. Vaccine Immunol. 2009
    InteractionPhysicalInteraction Rv0900shahanup86NASOperon (Functional linkage)
    P. Teriete,Y. Yao,A. Kolodzik,J. Yu,H. Song,M. Niederweis,FM. Marassi Mycobacterium tuberculosis Rv0899 adopts a mixed alpha/beta-structure and does not form a transmembrane beta-barrel. Biochemistry 2010
    InteractionPhysicalInteraction Rv0900shahanup86NASOperon (Functional linkage)
    I. Olsen, TB. Johansen et al. A novel IS element, ISMpa1, in Mycobacterium avium subsp. paratuberculosis. Vet. Microbiol. 2004
    InteractionPhysicalInteraction Rv0900shahanup86NASOperon (Functional linkage)
    authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null
    CitationIdentification of outer membrane proteins of Mycobacterium tuberculosis. H. Song, R. Sandie et al. Tuberculosis (Edinburgh, Scotland) 2008shahanup86NAS18439872Operon (Functional linkage)
    InteractionPhysicalInteraction Rv0901shahanup86NASOperon (Functional linkage)
    H. Song, R. Sandie et al. Identification of outer membrane proteins of Mycobacterium tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008
    InteractionPhysicalInteraction Rv0900shahanup86NASOperon (Functional linkage)
    H. Song, R. Sandie et al. Identification of outer membrane proteins of Mycobacterium tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008
    CitationMycobacterium tuberculosis Rv0899 adopts a mixed alpha/beta-structure and does not form a transmembrane beta-barrel. P. Teriete,Y. Yao,A. Kolodzik,J. Yu,H. Song,M. Niederweis,FM. Marassi Biochemistry 2010shahanup86NAS20199110Operon (Functional linkage)
    InteractionPhysicalInteraction Rv0901shahanup86NASOperon (Functional linkage)
    P. Teriete,Y. Yao,A. Kolodzik,J. Yu,H. Song,M. Niederweis,FM. Marassi Mycobacterium tuberculosis Rv0899 adopts a mixed alpha/beta-structure and does not form a transmembrane beta-barrel. Biochemistry 2010
    InteractionPhysicalInteraction Rv0900shahanup86NASOperon (Functional linkage)
    P. Teriete,Y. Yao,A. Kolodzik,J. Yu,H. Song,M. Niederweis,FM. Marassi Mycobacterium tuberculosis Rv0899 adopts a mixed alpha/beta-structure and does not form a transmembrane beta-barrel. Biochemistry 2010
    CitationAssessment of Mycobacterium tuberculosis OmpATb as a novel antigen for the diagnosis of bovine tuberculosis. I. Schiller, HM. Vordermeier et al. Clin. Vaccine Immunol. 2009shahanup86NAS19587150Operon (Functional linkage)
    InteractionPhysicalInteraction Rv0901shahanup86NASOperon (Functional linkage)
    I. Schiller, HM. Vordermeier et al. Assessment of Mycobacterium tuberculosis OmpATb as a novel antigen for the diagnosis of bovine tuberculosis. Clin. Vaccine Immunol. 2009
    CitationIdentification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall J. Proteome Res. nullshahanup86NAS15952732Operon (Functional linkage)
    InteractionPhysicalInteraction Rv0901shahanup86NASOperon (Functional linkage)
    authors,Y. Xiong,MJ. Chalmers,FP. Gao,TA. Cross,AG. Marshall Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. J. Proteome Res. null

    Comments