TB Genome Annotation Portal

Rv0886 (fprB)

Amino Acid Sequence

MPHVITQSCCNDASCVFACPVNCIHPTPDEPGFATSEMLYIDPVACVDCGACVTACPVSAIAPNTRLDFEQLPFVEINASYYPKRPAGVKLAPTSKLAPV
TPAAEVRVRRQPLTVAVVGSGPAAMYAADELLVQQGVQVNVFEKLPTPYGLVRSGVAPDHQNTKRVTRLFDRIAGHRRFRFYLNVEIGKHLGHAELLAHH
HAVLYAVGAPDDRRLTIDGMGLPGTGTATELVAWLNGHPDFNDLPVDLSHERVVIIGNGNVALDVARVLAADPHELAATDIADHALSALRNSAVREVVVA
ARRGPAHSAFTLPELIGLTAGADVVLDPGDHQRVLDDLAIVADPLTRNKLEILSTLGDGSAPARRVGRPRIRLAYRLTPRRVLGQRRAGGVQFSVTGTDE
LRQLDAGLVLTSIGYRGKPIPDLPFDEQAALVPNDGGRVIDPGTGEPVPGAYVAGWIKRGPTGFIGTNKSCSMQTVQALVADFNDGRLTDPVATPTALDQ
LVQARQPQAIGCAGWRAIDAAEIARGSADGRVRNKFTDVAEMLAAATSAPKEPLRRRVLARLRDLGQPIVLTVPL
(Nucleotide sequence available on KEGG)

Additional Information




Analysis of Positive Selection in Clinical Isolates *new*

Moldova (2,057)global set (5,195)
under significant positive selection?NONO
omega peak height (95%CI lower bound)2.47 (0.69)1.53 (0.66)
codons under selection
omega plots
genetic variants*linklink
statistics at each codonlinklink
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"


ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv0886/fprB, gene len: 1727 bp, num TA sites: 26
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBionon-essential7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Micronon-essential 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASnon-essential BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathuncertainM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathuncertainM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=0.94)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifenon-essential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifenon-essentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=-0.213)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysnon-essentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysnon-essentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=0.18)YM rich vs minimal mediumresampling

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv0886 (fprB)

    PropertyValueCreatorEvidencePMIDComment
    TermTBRXN:FRDO3r ferredoxin oxidoreductase - ISSnjamshidiISS15741336|12614197|12071965PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). See also PMID: 16581251 for additiona GPR
    F. Fischer, D. Raimondi et al. Mycobacterium tuberculosis FprA, a novel bacterial NADPH-ferredoxin reductase. Eur. J. Biochem. 2002
    CitationThe preponderance of P450s in the Mycobacterium tuberculosis genome. KJ. McLean, D. Clift et al. Trends Microbiol. 2006njamshidiISS15741336|12614197|16581251|12071965PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). See also PMID: 16581251 for additiona GPR
    TermTBRXN:FRDO3r ferredoxin oxidoreductase - ISSnjamshidiISS15741336|12614197|12071965PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). See also PMID: 16581251 for additiona GPR
    KJ. McLean, D. Clift et al. The preponderance of P450s in the Mycobacterium tuberculosis genome. Trends Microbiol. 2006
    TermTBRXN:FRDO3r ferredoxin oxidoreductase - IDAnjamshidiIDA15741336|12614197|12071965PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). See also PMID: 16581251 for additiona GPR
    F. Fischer, D. Raimondi et al. Mycobacterium tuberculosis FprA, a novel bacterial NADPH-ferredoxin reductase. Eur. J. Biochem. 2002
    CitationThe preponderance of P450s in the Mycobacterium tuberculosis genome. KJ. McLean, D. Clift et al. Trends Microbiol. 2006njamshidiIDA15741336|12614197|16581251|12071965PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). See also PMID: 16581251 for additiona GPR
    TermTBRXN:FRDO3r ferredoxin oxidoreductase - IDAnjamshidiIDA15741336|12614197|12071965PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). See also PMID: 16581251 for additiona GPR
    KJ. McLean, D. Clift et al. The preponderance of P450s in the Mycobacterium tuberculosis genome. Trends Microbiol. 2006
    CitationMycobacterium tuberculosis FprA, a novel bacterial NADPH-ferredoxin reductase. F. Fischer, D. Raimondi et al. Eur. J. Biochem. 2002njamshidiISS15741336|12614197|12071965PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). See also PMID: 16581251 for additiona GPR
    TermTBRXN:FRDO3r ferredoxin oxidoreductase - ISSnjamshidiISS15741336|12614197|12071965PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). See also PMID: 16581251 for additiona GPR
    F. Fischer, D. Raimondi et al. Mycobacterium tuberculosis FprA, a novel bacterial NADPH-ferredoxin reductase. Eur. J. Biochem. 2002
    CitationModulation of cooperativity in Mycobacterium tuberculosis NADPH-ferredoxin reductase: cation-and pH-induced alterations in native conformation and destabilization of the NADP+-binding domain. AN. Bhatt, N. Shukla et al. Protein Sci. 2005njamshidiISS15741336|12614197|12071965PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). See also PMID: 16581251 for additiona GPR
    TermTBRXN:FRDO3r ferredoxin oxidoreductase - ISSnjamshidiISS15741336|12614197|12071965PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). See also PMID: 16581251 for additiona GPR
    AN. Bhatt, N. Shukla et al. Modulation of cooperativity in Mycobacterium tuberculosis NADPH-ferredoxin reductase: cation-and pH-induced alterations in native conformation and destabilization of the NADP+-binding domain. Protein Sci. 2005
    CitationKinetic, spectroscopic and thermodynamic characterization of the Mycobacterium tuberculosis adrenodoxin reductase homologue FprA. KJ. McLean, NS. Scrutton et al. Biochem. J. 2003njamshidiISS15741336|12071965|12614197PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). See also PMID: 16581251 for additiona GPR
    TermTBRXN:FRDO3r ferredoxin oxidoreductase - ISSnjamshidiISS15741336|12614197|12071965PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). See also PMID: 16581251 for additiona GPR
    KJ. McLean, NS. Scrutton et al. Kinetic, spectroscopic and thermodynamic characterization of the Mycobacterium tuberculosis adrenodoxin reductase homologue FprA. Biochem. J. 2003
    CitationMycobacterium tuberculosis FprA, a novel bacterial NADPH-ferredoxin reductase. F. Fischer, D. Raimondi et al. Eur. J. Biochem. 2002njamshidiISS15741336|12614197|12071965PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). See also PMID: 16581251 for additiona GPR
    CitationMycobacterium tuberculosis FprA, a novel bacterial NADPH-ferredoxin reductase. F. Fischer, D. Raimondi et al. Eur. J. Biochem. 2002njamshidiIDA15741336|12614197|12071965PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). See also PMID: 16581251 for additiona GPR
    TermTBRXN:FRDO3r ferredoxin oxidoreductase - IDAnjamshidiIDA15741336|12614197|12071965PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). See also PMID: 16581251 for additiona GPR
    F. Fischer, D. Raimondi et al. Mycobacterium tuberculosis FprA, a novel bacterial NADPH-ferredoxin reductase. Eur. J. Biochem. 2002
    CitationModulation of cooperativity in Mycobacterium tuberculosis NADPH-ferredoxin reductase: cation-and pH-induced alterations in native conformation and destabilization of the NADP+-binding domain. AN. Bhatt, N. Shukla et al. Protein Sci. 2005njamshidiIDA15741336|12614197|12071965PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). See also PMID: 16581251 for additiona GPR
    TermTBRXN:FRDO3r ferredoxin oxidoreductase - IDAnjamshidiIDA15741336|12614197|12071965PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). See also PMID: 16581251 for additiona GPR
    AN. Bhatt, N. Shukla et al. Modulation of cooperativity in Mycobacterium tuberculosis NADPH-ferredoxin reductase: cation-and pH-induced alterations in native conformation and destabilization of the NADP+-binding domain. Protein Sci. 2005
    CitationKinetic, spectroscopic and thermodynamic characterization of the Mycobacterium tuberculosis adrenodoxin reductase homologue FprA. KJ. McLean, NS. Scrutton et al. Biochem. J. 2003njamshidiIDA15741336|12071965|12614197PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). See also PMID: 16581251 for additiona GPR
    TermTBRXN:FRDO3r ferredoxin oxidoreductase - IDAnjamshidiIDA15741336|12614197|12071965PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). See also PMID: 16581251 for additiona GPR
    KJ. McLean, NS. Scrutton et al. Kinetic, spectroscopic and thermodynamic characterization of the Mycobacterium tuberculosis adrenodoxin reductase homologue FprA. Biochem. J. 2003
    CitationMycobacterium tuberculosis FprA, a novel bacterial NADPH-ferredoxin reductase. F. Fischer, D. Raimondi et al. Eur. J. Biochem. 2002njamshidiIDA15741336|12614197|12071965PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred). See also PMID: 16581251 for additiona GPR
    CitationMycobacterium tuberculosis FprA, a novel bacterial NADPH-ferredoxin reductase. F. Fischer, D. Raimondi et al. Eur. J. Biochem. 2002njamshidiIDA15741336|12614197|12071965PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred).
    TermTBRXN:FRDO2r ferredoxin oxidoreductase - IDAnjamshidiIDA15741336|12614197|12071965PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred).
    F. Fischer, D. Raimondi et al. Mycobacterium tuberculosis FprA, a novel bacterial NADPH-ferredoxin reductase. Eur. J. Biochem. 2002
    CitationMycobacterium tuberculosis FprA, a novel bacterial NADPH-ferredoxin reductase. F. Fischer, D. Raimondi et al. Eur. J. Biochem. 2002njamshidiISS15741336|12614197|12071965PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred).
    TermTBRXN:FRDO2r ferredoxin oxidoreductase - ISSnjamshidiISS15741336|12614197|12071965PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred).
    F. Fischer, D. Raimondi et al. Mycobacterium tuberculosis FprA, a novel bacterial NADPH-ferredoxin reductase. Eur. J. Biochem. 2002
    CitationModulation of cooperativity in Mycobacterium tuberculosis NADPH-ferredoxin reductase: cation-and pH-induced alterations in native conformation and destabilization of the NADP+-binding domain. AN. Bhatt, N. Shukla et al. Protein Sci. 2005njamshidiISS15741336|12614197|12071965PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred).
    TermTBRXN:FRDO2r ferredoxin oxidoreductase - ISSnjamshidiISS15741336|12614197|12071965PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred).
    AN. Bhatt, N. Shukla et al. Modulation of cooperativity in Mycobacterium tuberculosis NADPH-ferredoxin reductase: cation-and pH-induced alterations in native conformation and destabilization of the NADP+-binding domain. Protein Sci. 2005
    CitationKinetic, spectroscopic and thermodynamic characterization of the Mycobacterium tuberculosis adrenodoxin reductase homologue FprA. KJ. McLean, NS. Scrutton et al. Biochem. J. 2003njamshidiISS15741336|12071965|12614197PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred).
    TermTBRXN:FRDO2r ferredoxin oxidoreductase - ISSnjamshidiISS15741336|12614197|12071965PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred).
    KJ. McLean, NS. Scrutton et al. Kinetic, spectroscopic and thermodynamic characterization of the Mycobacterium tuberculosis adrenodoxin reductase homologue FprA. Biochem. J. 2003
    CitationMycobacterium tuberculosis FprA, a novel bacterial NADPH-ferredoxin reductase. F. Fischer, D. Raimondi et al. Eur. J. Biochem. 2002njamshidiISS15741336|12614197|12071965PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred).
    TermTBRXN:FRDO2r ferredoxin oxidoreductase - ISSnjamshidiISS15741336|12614197|12071965PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred).
    F. Fischer, D. Raimondi et al. Mycobacterium tuberculosis FprA, a novel bacterial NADPH-ferredoxin reductase. Eur. J. Biochem. 2002
    CitationMycobacterium tuberculosis FprA, a novel bacterial NADPH-ferredoxin reductase. F. Fischer, D. Raimondi et al. Eur. J. Biochem. 2002njamshidiIDA15741336|12614197|12071965PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred).
    TermTBRXN:FRDO2r ferredoxin oxidoreductase - IDAnjamshidiIDA15741336|12614197|12071965PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred).
    F. Fischer, D. Raimondi et al. Mycobacterium tuberculosis FprA, a novel bacterial NADPH-ferredoxin reductase. Eur. J. Biochem. 2002
    CitationModulation of cooperativity in Mycobacterium tuberculosis NADPH-ferredoxin reductase: cation-and pH-induced alterations in native conformation and destabilization of the NADP+-binding domain. AN. Bhatt, N. Shukla et al. Protein Sci. 2005njamshidiIDA15741336|12614197|12071965PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred).
    TermTBRXN:FRDO2r ferredoxin oxidoreductase - IDAnjamshidiIDA15741336|12614197|12071965PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred).
    AN. Bhatt, N. Shukla et al. Modulation of cooperativity in Mycobacterium tuberculosis NADPH-ferredoxin reductase: cation-and pH-induced alterations in native conformation and destabilization of the NADP+-binding domain. Protein Sci. 2005
    CitationKinetic, spectroscopic and thermodynamic characterization of the Mycobacterium tuberculosis adrenodoxin reductase homologue FprA. KJ. McLean, NS. Scrutton et al. Biochem. J. 2003njamshidiIDA15741336|12071965|12614197PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred).
    TermTBRXN:FRDO2r ferredoxin oxidoreductase - IDAnjamshidiIDA15741336|12614197|12071965PMID: 12071965, 15741336, 12614197, 12071965. details on adrenodoxin (structure, charge, stoichiometry and have not yet been clearly elucidated, some of these have been inferred).
    KJ. McLean, NS. Scrutton et al. Kinetic, spectroscopic and thermodynamic characterization of the Mycobacterium tuberculosis adrenodoxin reductase homologue FprA. Biochem. J. 2003
    CitationFunctional genomics reveals extended roles of the Mycobacterium tuberculosis stress response factor sigmaH. S. Mehra & D. Kaushal J. Bacteriol. 2009sourish10IMP19376862Co-expression (Functional linkage)
    InteractionTranscription Rv3223csourish10IMPCo-expression (Functional linkage)
    S. Mehra & D. Kaushal Functional genomics reveals extended roles of the Mycobacterium tuberculosis stress response factor sigmaH. J. Bacteriol. 2009

    Comments