Rv0868c (moaD2)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: molybdenum cofactor biosynthesis protein D 2 moaD2
- REFSEQ: molybdenum cofactor biosynthesis protein D
- PATRIC: Molybdenum cofactor biosynthesis protein MoaD
- TUBERCULIST: Probable molybdenum cofactor biosynthesis protein D 2 MoaD2 (molybdopterin converting factor small subunit) (molybdopterin [MPT] converting factor subunit 1)
- NCBI: Probable molybdenum cofactor biosynthesis protein D 2 MoaD2 (molybdopterin converting factor small subunit) (molybdopterin [MPT] converting factor, subunit 1)
- updated information (H37Rv4):
  - gene name: moaD2
  - function:
  - reference:
Type: Not Target
Start: 965983
End: 966261
Operon:

Trans-membrane region:
Role: I.G.4 - Molybdopterin
GO terms:
- No terms assigned.
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB

Top 10 Homologs in PDB (as of Nov 2020):

PDB	aa ident	species	PDB title
6JBZ	98%	Mycobacterium tuberculosis	Structural analysis of molybdopterin synthases from two mycobacteria pathogens
6JC0	56%	Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)	Structural analysis of molybdopterin synthases from two mycobacteria pathogens

Links to additional information on moaD2:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 0.971 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

VTQVSDESAGIQVTVRYFAAARAAAGAGSEKVTLRSGATVAELIDGLSVRDVRLATVLSRCSYLRDGIVVRDDAVALSAGDTIDVLPPFAGG

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Non-Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 6 sites
Non-Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 6 sites
Non-Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 6 sites
Non-Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 7 sites
Non-Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 7 sites
Non-Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Non-Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 0.67
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- No bindings to other targets were found.

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Rv0818 (-)
- Rv3416 (whiB3)
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Rv2595 (vapB40)
- Rv3167c (-)

TBCAP

Tubculosis Community Annotation Project (

Slayden et al., 2013

Rv0868c (moaD2)

Property	Value	Creator	Evidence	PMID	Comment
Interaction	ActivatedBy Rv3323c	shahanup86	RCA		Domain Fusion(Functional-linkage) authors,MS. Cortese,AB. Caplan,RL. Crawford Structural, functional, and evolutionary analysis of moeZ, a gene encoding an enzyme required for the synthesis of the Pseudomonas metabolite, pyridine-2,6-bis(thiocarboxylic acid). BMC Evol. Biol. 2002
Interaction	ActivatedBy Rv3323c	vashishtrv	RCA		Domain Fusion(Functional-linkage) authors,MS. Cortese,AB. Caplan,RL. Crawford Structural, functional, and evolutionary analysis of moeZ, a gene encoding an enzyme required for the synthesis of the Pseudomonas metabolite, pyridine-2,6-bis(thiocarboxylic acid). BMC Evol. Biol. 2002
Interaction	PhysicalInteraction Rv3116	kaveri.verma	ISS		Structural Analysis CT. Jurgenson, KE. Burns et al. Crystal structure of a sulfur carrier protein complex found in the cysteine biosynthetic pathway of Mycobacterium tuberculosis. Biochemistry 2008
Citation	IscS functions as a primary sulfur-donating enzyme by interacting specifically with MoeB and MoaD in the biosynthesis of molybdopterin in Escherichia coli. authors,W. Zhang,A. Urban,H. Mihara,S. Leimkhler,T. Kurihara,N. Esaki J. Biol. Chem. 2010	girishgene07	ISO	19946146	co-occurrence (functional linkage)
Interaction	Activation Rv3206c	girishgene07	ISO		co-occurrence (functional linkage) authors,W. Zhang,A. Urban,H. Mihara,S. Leimkhler,T. Kurihara,N. Esaki IscS functions as a primary sulfur-donating enzyme by interacting specifically with MoeB and MoaD in the biosynthesis of molybdopterin in Escherichia coli. J. Biol. Chem. 2010
Interaction	Activation Rv3025c	girishgene07	ISO		co-occurrence (functional linkage) authors,W. Zhang,A. Urban,H. Mihara,S. Leimkhler,T. Kurihara,N. Esaki IscS functions as a primary sulfur-donating enzyme by interacting specifically with MoeB and MoaD in the biosynthesis of molybdopterin in Escherichia coli. J. Biol. Chem. 2010
Citation	[Digestive tract disease in the surgical department and acute abdomen]. authors,K. Mieno Kango Gijutsu 1979	girishgene07	ISO	259713	co-occurrence (functional linkage)
Interaction	Activation Rv3206c	girishgene07	ISO		co-occurrence (functional linkage) authors,K. Mieno [Digestive tract disease in the surgical department and acute abdomen]. Kango Gijutsu 1979
Interaction	Activation Rv3025c	girishgene07	ISO		co-occurrence (functional linkage) authors,K. Mieno [Digestive tract disease in the surgical department and acute abdomen]. Kango Gijutsu 1979
Citation	The iscS gene in Escherichia coli is required for the biosynthesis of 4-thiouridine, thiamin, and NAD. authors,CT. Lauhon,R. Kambampati J. Biol. Chem. 2000	girishgene07	ISO	10781607	co-occurrence (functional linkage)
Interaction	Activation Rv3206c	girishgene07	ISO		co-occurrence (functional linkage) authors,CT. Lauhon,R. Kambampati The iscS gene in Escherichia coli is required for the biosynthesis of 4-thiouridine, thiamin, and NAD. J. Biol. Chem. 2000
Interaction	Activation Rv3025c	girishgene07	ISO		co-occurrence (functional linkage) authors,CT. Lauhon,R. Kambampati The iscS gene in Escherichia coli is required for the biosynthesis of 4-thiouridine, thiamin, and NAD. J. Biol. Chem. 2000
Interaction	PhysicalInteraction Rv0866	sourish10	ISS		authors,R. Sanishvili,S. Beasley,T. Skarina,D. Glesne,A. Joachimiak,A. Edwards,A. Savchenko The crystal structure of Escherichia coli MoaB suggests a probable role in molybdenum cofactor synthesis. J. Biol. Chem. 2004
Interaction	PhysicalInteraction Rv0866	sourish10	ISS		EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Interaction	PhysicalInteraction Rv0866	ahal4789	ISS		authors,R. Sanishvili,S. Beasley,T. Skarina,D. Glesne,A. Joachimiak,A. Edwards,A. Savchenko The crystal structure of Escherichia coli MoaB suggests a probable role in molybdenum cofactor synthesis. J. Biol. Chem. 2004
Interaction	PhysicalInteraction Rv0866	ahal4789	ISS		EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Citation	Functional analysis of molybdopterin biosynthesis in mycobacteria identifies a fused molybdopterin synthase in Mycobacterium tuberculosis. authors,MJ. Williams,BD. Kana,V. Mizrahi J. Bacteriol. 2011	mwilliams		20971904	Deletion in M. tuberculosis results in reduced MoCo biosynthesis
Citation	Functional analysis of molybdopterin biosynthesis in mycobacteria identifies a fused molybdopterin synthase in Mycobacterium tuberculosis. authors,MJ. Williams,BD. Kana,V. Mizrahi J. Bacteriol. 2011	mwilliams		20971904	Expression in M. smegmatis moaD mutant restores MoCo biosynthesis

Property

Value

Creator

Evidence

PMID

Comment

Interaction

ActivatedBy Rv3323c

shahanup86

RCA

Domain Fusion(Functional-linkage)
authors,MS. Cortese,AB. Caplan,RL. Crawford Structural, functional, and evolutionary analysis of moeZ, a gene encoding an enzyme required for the synthesis of the Pseudomonas metabolite, pyridine-2,6-bis(thiocarboxylic acid). BMC Evol. Biol. 2002

Interaction

ActivatedBy Rv3323c

vashishtrv

RCA

Interaction

PhysicalInteraction Rv3116

kaveri.verma

ISS

Structural Analysis
CT. Jurgenson, KE. Burns et al. Crystal structure of a sulfur carrier protein complex found in the cysteine biosynthetic pathway of Mycobacterium tuberculosis. Biochemistry 2008

Citation

IscS functions as a primary sulfur-donating enzyme by interacting specifically with MoeB and MoaD in the biosynthesis of molybdopterin in Escherichia coli. authors,W. Zhang,A. Urban,H. Mihara,S. Leimkhler,T. Kurihara,N. Esaki J. Biol. Chem. 2010

girishgene07

ISO

19946146

co-occurrence (functional linkage)

Interaction

Activation Rv3206c

girishgene07

ISO

co-occurrence (functional linkage)
authors,W. Zhang,A. Urban,H. Mihara,S. Leimkhler,T. Kurihara,N. Esaki IscS functions as a primary sulfur-donating enzyme by interacting specifically with MoeB and MoaD in the biosynthesis of molybdopterin in Escherichia coli. J. Biol. Chem. 2010

Interaction

Activation Rv3025c

girishgene07

ISO

Citation

[Digestive tract disease in the surgical department and acute abdomen]. authors,K. Mieno Kango Gijutsu 1979

girishgene07

ISO

259713

co-occurrence (functional linkage)

Interaction

Activation Rv3206c

girishgene07

ISO

co-occurrence (functional linkage)
authors,K. Mieno [Digestive tract disease in the surgical department and acute abdomen]. Kango Gijutsu 1979

Interaction

Activation Rv3025c

girishgene07

ISO

co-occurrence (functional linkage)
authors,K. Mieno [Digestive tract disease in the surgical department and acute abdomen]. Kango Gijutsu 1979

Citation

The iscS gene in Escherichia coli is required for the biosynthesis of 4-thiouridine, thiamin, and NAD. authors,CT. Lauhon,R. Kambampati J. Biol. Chem. 2000

girishgene07

ISO

10781607

co-occurrence (functional linkage)

Interaction

Activation Rv3206c

girishgene07

ISO

co-occurrence (functional linkage)
authors,CT. Lauhon,R. Kambampati The iscS gene in Escherichia coli is required for the biosynthesis of 4-thiouridine, thiamin, and NAD. J. Biol. Chem. 2000

Interaction

Activation Rv3025c

girishgene07

ISO

co-occurrence (functional linkage)
authors,CT. Lauhon,R. Kambampati The iscS gene in Escherichia coli is required for the biosynthesis of 4-thiouridine, thiamin, and NAD. J. Biol. Chem. 2000

Interaction

PhysicalInteraction Rv0866

sourish10

ISS

authors,R. Sanishvili,S. Beasley,T. Skarina,D. Glesne,A. Joachimiak,A. Edwards,A. Savchenko The crystal structure of Escherichia coli MoaB suggests a probable role in molybdenum cofactor synthesis. J. Biol. Chem. 2004

Interaction

PhysicalInteraction Rv0866

sourish10

ISS

EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007

Interaction

PhysicalInteraction Rv0866

ahal4789

ISS

Interaction

PhysicalInteraction Rv0866

ahal4789

ISS

Citation

Functional analysis of molybdopterin biosynthesis in mycobacteria identifies a fused molybdopterin synthase in Mycobacterium tuberculosis. authors,MJ. Williams,BD. Kana,V. Mizrahi J. Bacteriol. 2011

mwilliams

20971904

Deletion in M. tuberculosis results in reduced MoCo biosynthesis

Citation

Functional analysis of molybdopterin biosynthesis in mycobacteria identifies a fused molybdopterin synthase in Mycobacterium tuberculosis. authors,MJ. Williams,BD. Kana,V. Mizrahi J. Bacteriol. 2011

mwilliams

20971904

Expression in M. smegmatis moaD mutant restores MoCo biosynthesis

Comments