TB Genome Annotation Portal

Rv0868c (moaD2)

Amino Acid Sequence

VTQVSDESAGIQVTVRYFAAARAAAGAGSEKVTLRSGATVAELIDGLSVRDVRLATVLSRCSYLRDGIVVRDDAVALSAGDTIDVLPPFAGG
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv0868c/moaD2, gene len: 278 bp, num TA sites: 7
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBionon-essential7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Micronon-essential 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASnon-essential BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathnon-essentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathnon-essentialM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=0.99)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifenon-essential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifenon-essentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=-0.028)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysnon-essentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysnon-essentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=0.87)YM rich vs minimal mediumresampling

Analysis of Positive Selection in Clinical Isolates *new*

global set of 10,626 Mtb clinical isolates
under significant positive selection?NO
omega peak height (95%CI lower bound)1.73 (0.68)
codons under selection
omega plotsomega plot across ORF
genetic variants*link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"



TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: see table of TFOE interactions below

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

      • No bindings to other targets were found.

    Interactions based on TFOE data (Rustad et al. 2014)

    TFOE = Transcription Factor Over-Expression study
    significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01

    genedysregulated by OE ofLFC
    Rv0868c/moaD2Rv0818/glnR1.45
    Rv0868c/moaD2Rv3416/whiB31.09
    Rv0868c/moaD2Rv2595/vapB40-1.04
    Rv0868c/moaD2Rv3167c/--2.99


    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv0868c (moaD2)

    PropertyValueCreatorEvidencePMIDComment
    InteractionActivatedBy Rv3323cshahanup86RCADomain Fusion(Functional-linkage)
    authors,MS. Cortese,AB. Caplan,RL. Crawford Structural, functional, and evolutionary analysis of moeZ, a gene encoding an enzyme required for the synthesis of the Pseudomonas metabolite, pyridine-2,6-bis(thiocarboxylic acid). BMC Evol. Biol. 2002
    InteractionActivatedBy Rv3323cvashishtrvRCADomain Fusion(Functional-linkage)
    authors,MS. Cortese,AB. Caplan,RL. Crawford Structural, functional, and evolutionary analysis of moeZ, a gene encoding an enzyme required for the synthesis of the Pseudomonas metabolite, pyridine-2,6-bis(thiocarboxylic acid). BMC Evol. Biol. 2002
    InteractionPhysicalInteraction Rv3116kaveri.vermaISSStructural Analysis
    CT. Jurgenson, KE. Burns et al. Crystal structure of a sulfur carrier protein complex found in the cysteine biosynthetic pathway of Mycobacterium tuberculosis. Biochemistry 2008
    CitationIscS functions as a primary sulfur-donating enzyme by interacting specifically with MoeB and MoaD in the biosynthesis of molybdopterin in Escherichia coli. authors,W. Zhang,A. Urban,H. Mihara,S. Leimkhler,T. Kurihara,N. Esaki J. Biol. Chem. 2010girishgene07ISO19946146co-occurrence (functional linkage)
    InteractionActivation Rv3206cgirishgene07ISOco-occurrence (functional linkage)
    authors,W. Zhang,A. Urban,H. Mihara,S. Leimkhler,T. Kurihara,N. Esaki IscS functions as a primary sulfur-donating enzyme by interacting specifically with MoeB and MoaD in the biosynthesis of molybdopterin in Escherichia coli. J. Biol. Chem. 2010
    InteractionActivation Rv3025cgirishgene07ISOco-occurrence (functional linkage)
    authors,W. Zhang,A. Urban,H. Mihara,S. Leimkhler,T. Kurihara,N. Esaki IscS functions as a primary sulfur-donating enzyme by interacting specifically with MoeB and MoaD in the biosynthesis of molybdopterin in Escherichia coli. J. Biol. Chem. 2010
    Citation[Digestive tract disease in the surgical department and acute abdomen]. authors,K. Mieno Kango Gijutsu 1979girishgene07ISO259713co-occurrence (functional linkage)
    InteractionActivation Rv3206cgirishgene07ISOco-occurrence (functional linkage)
    authors,K. Mieno [Digestive tract disease in the surgical department and acute abdomen]. Kango Gijutsu 1979
    InteractionActivation Rv3025cgirishgene07ISOco-occurrence (functional linkage)
    authors,K. Mieno [Digestive tract disease in the surgical department and acute abdomen]. Kango Gijutsu 1979
    CitationThe iscS gene in Escherichia coli is required for the biosynthesis of 4-thiouridine, thiamin, and NAD. authors,CT. Lauhon,R. Kambampati J. Biol. Chem. 2000girishgene07ISO10781607co-occurrence (functional linkage)
    InteractionActivation Rv3206cgirishgene07ISOco-occurrence (functional linkage)
    authors,CT. Lauhon,R. Kambampati The iscS gene in Escherichia coli is required for the biosynthesis of 4-thiouridine, thiamin, and NAD. J. Biol. Chem. 2000
    InteractionActivation Rv3025cgirishgene07ISOco-occurrence (functional linkage)
    authors,CT. Lauhon,R. Kambampati The iscS gene in Escherichia coli is required for the biosynthesis of 4-thiouridine, thiamin, and NAD. J. Biol. Chem. 2000
    InteractionPhysicalInteraction Rv0866sourish10ISS
    authors,R. Sanishvili,S. Beasley,T. Skarina,D. Glesne,A. Joachimiak,A. Edwards,A. Savchenko The crystal structure of Escherichia coli MoaB suggests a probable role in molybdenum cofactor synthesis. J. Biol. Chem. 2004
    InteractionPhysicalInteraction Rv0866sourish10ISS
    EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
    InteractionPhysicalInteraction Rv0866ahal4789ISS
    authors,R. Sanishvili,S. Beasley,T. Skarina,D. Glesne,A. Joachimiak,A. Edwards,A. Savchenko The crystal structure of Escherichia coli MoaB suggests a probable role in molybdenum cofactor synthesis. J. Biol. Chem. 2004
    InteractionPhysicalInteraction Rv0866ahal4789ISS
    EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
    CitationFunctional analysis of molybdopterin biosynthesis in mycobacteria identifies a fused molybdopterin synthase in Mycobacterium tuberculosis. authors,MJ. Williams,BD. Kana,V. Mizrahi J. Bacteriol. 2011mwilliams20971904Deletion in M. tuberculosis results in reduced MoCo biosynthesis
    CitationFunctional analysis of molybdopterin biosynthesis in mycobacteria identifies a fused molybdopterin synthase in Mycobacterium tuberculosis. authors,MJ. Williams,BD. Kana,V. Mizrahi J. Bacteriol. 2011mwilliams20971904Expression in M. smegmatis moaD mutant restores MoCo biosynthesis

    Comments