Rv0866 (moaE2)
Current annotations:
TBCAP: (community-based annotations - see table at bottom of page )
TBDB: molybdopterin synthase catalytic subunit
REFSEQ: molybdenum cofactor biosynthesis protein E2
PATRIC: Molybdenum cofactor biosynthesis protein MoaE
TUBERCULIST: Probable molybdenum cofactor biosynthesis protein E2 MoaE2 (molybdopterin converting factor large subunit) (molybdopterin [MPT] converting factor subunit 2)
NCBI: Probable molybdenum cofactor biosynthesis protein E2 MoaE2 (molybdopterin converting factor large subunit) (molybdopterin [MPT] converting factor, subunit 2)
updated information (H37Rv4):
gene name: moaE2
function:
reference:
Coordinates in H37Rv: 963869 - 964294
Gene length: 426 bp (with stop codon), 141 aa (without stop codon)
Operon:
Trans-membrane region:
Role: I.G.4 - Molybdopterin
GO terms:
GO:0032324 - molybdopterin cofactor biosynthetic process (Uniprot)
GO:0030366 - molybdopterin synthase activity (Uniprot)
GO:0016740 - transferase activity (Uniprot)
GO:0006777 - Mo-molybdopterin cofactor biosynthetic process (Uniprot)
GO:0005829 - cytosol (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Latest Homologs in PDB
Top 10 Homologs in PDB (as of Apr 2026): PDB aa ident species PDB title 9UGK 100% Mycobacterium tuberculosis H37Rv Crystal Structure of Rv0866 from Mycobacterium tuberculosis 6JBZ 100% Mycobacterium tuberculosis Structural analysis of molybdopterin synthases from two mycobacteria pathogens 6JC0 64% Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) Structural analysis of molybdopterin synthases from two mycobacteria pathogens 2WP4 40% MYCOBACTERIUM TUBERCULOSIS crystal structure of Rv3119 from Mycobacterium tuberculosis 9JBD 39% Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) Crystal Structure of the MoaE-like domain within Rv3323c from Mycobacterium tuberculosis
Links to additional information on moaE2:
Amino Acid Sequence
MTQVLRAALTDQPIFLAEHEELVSHRSAGAIVGFVGMIRDRDGGRGVLRLEYSAHPSAAQVLADLVAEVAEESSGVRAVAASHRIGVLQVGEAALVAAVA
ADHRRAAFGTCAHLVETIKARLPVWKHQFFEDGTDEWVGSV
(
Nucleotide sequence available on
KEGG )
Additional Information
MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb
TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions
Rv0866/moaE2,
gene len: 425 bp, num TA sites: 4
condition dataset call medium method notes
in-vitro DeJesus 2017 mBio non-essential 7H9 HMM fully saturated, 14 TnSeq libraries combined
in-vitro Sassetti 2003 Mol Micro non-essential 7H9 TRASH essential if hybridization ratio<0.2
in-vivo (mice) Sassetti 2003 PNAS non-essential BL6 mice TRASH essential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol) Griffin 2011 PPath non-essential M9 minimal+glycerol Gumbel 2 replicates; Padj<0.05
in-vitro (cholesterol) Griffin 2011 PPath non-essential M9 minimal+cholesterol Gumbel 3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPath NO (LFC=-1.21) cholesterol vs glycerol resampling-SR YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitro Smith 2022 eLife non-essential 7H9 HMM 6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice) Smith 2022 eLife non-essential BL6 mice HMM 6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in mice Smith 2022 eLife NO (LFC=-0.503) in-vivo vs in-vitro ZINB YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal) Minato 2019 mSys non-essential minimal medium HMM
in-vitro (YM rich medium) Minato 2019 mSys non-essential YM rich medium HMM 7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich medium Minato 2019 mSys NO (LFC=0.42) YM rich vs minimal medium resampling
Analysis of Positive Selection in Clinical Isolates
*new*
data from Culviner et al (2025) (55,259 Mtb clinical isolates)
overall pN/pS for Rv0866: 0.626067952
lineage-specific pN/pS in L1: 0.597610317
lineage-specific pN/pS in L2: 0.717132381
lineage-specific pN/pS in L3: 0.752546326
lineage-specific pN/pS in L4: 0.584330088
Analysis of dN/dS (omega) in a global collection of 10k Mtb clinical isolates using GenomegaMap (Window model)
clinical isolates collection: global set of 10,626 Mtb genomes
In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.
global set of 10,626 Mtb clinical isolates
under significant positive selection? NO
omega peak height (95%CI lower bound) 1.18 (0.51)
codons under selection
omega plots
genetic variants* link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"
TnSeq Data No data currently available.
No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
No Proteomic data currently available for this Target.
Regulatory Relationships from Systems Biology
BioCyc
Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology )
NOTE:
see table of TFOE interactions below
Interactions based on ChIPSeq data
RNA processing and modification
Energy production and conversion
Chromatin structure and dynamics
Amino acid transport and metabolism
Cell cycle control, cell division, chromosome partitioning
Carbohydrate transport and metabolism
Nucleotide transport and metabolism
Lipid transport and metabolism
Coenzyme transport and metabolism
Translation, ribosomal structure and biogenesis
Cell wall/membrane/envelope biogenesis
Replication, recombination and repair
Posttranslational modification, protein turnover, chaperones
Secondary metabolites biosynthesis, transport and catabolism
Inorganic ion transport and metabolism
General function prediction only
Intracellular trafficking, secretion, and vesicular transport
Signal transduction mechanisms
Differentially expressed as result of RNASeq in glycerol environment (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
Conditionally essential as result of TNSeq (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
Binds To:
No bindings to other targets were found.
Bound By:
No bindings from other targets were found.
Binds To:
No bindings to other targets were found.
Bound By:
No bindings to other targets were found.
TFOE = Transcription Factor Over-Expression study
significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01
no significant interactions found
Upregulates:
Does not upregulate other genes.
Upregulated by:
Not upregulated by other genes.
Downregulates:
Does not downregulate other genes.
Downregulated by:
Not downregulated by other genes.
Property Value Creator Evidence PMID Comment
Interaction ActivatedBy Rv3323c shahanup86 RCA Domain Fusion(Functional-linkage)authors,MS. Cortese,AB. Caplan,RL. Crawford Structural, functional, and evolutionary analysis of moeZ, a gene encoding an enzyme required for the synthesis of the Pseudomonas metabolite, pyridine-2,6-bis(thiocarboxylic acid). BMC Evol. Biol. 2002
Interaction ActivatedBy Rv3323c vashishtrv RCA Domain Fusion(Functional-linkage)authors,MS. Cortese,AB. Caplan,RL. Crawford Structural, functional, and evolutionary analysis of moeZ, a gene encoding an enzyme required for the synthesis of the Pseudomonas metabolite, pyridine-2,6-bis(thiocarboxylic acid). BMC Evol. Biol. 2002
Citation Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. EP. Williams, JH. Lee et al. J. Bacteriol. 2007 sourish10 ISS 17384187 None
Interaction PhysicalInteraction Rv0868c sourish10 ISS EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Citation The crystal structure of Escherichia coli MoaB suggests a probable role in molybdenum cofactor synthesis. authors,R. Sanishvili,S. Beasley,T. Skarina,D. Glesne,A. Joachimiak,A. Edwards,A. Savchenko J. Biol. Chem. 2004 ahal4789 ISS 15269205 None
Interaction PhysicalInteraction Rv0868c ahal4789 ISS authors,R. Sanishvili,S. Beasley,T. Skarina,D. Glesne,A. Joachimiak,A. Edwards,A. Savchenko The crystal structure of Escherichia coli MoaB suggests a probable role in molybdenum cofactor synthesis. J. Biol. Chem. 2004
Citation Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. EP. Williams, JH. Lee et al. J. Bacteriol. 2007 ahal4789 ISS 17384187 None
Interaction PhysicalInteraction Rv0868c ahal4789 ISS EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Citation The crystal structure of Escherichia coli MoaB suggests a probable role in molybdenum cofactor synthesis. authors,R. Sanishvili,S. Beasley,T. Skarina,D. Glesne,A. Joachimiak,A. Edwards,A. Savchenko J. Biol. Chem. 2004 sourish10 ISS 15269205 None
Interaction PhysicalInteraction Rv0868c sourish10 ISS authors,R. Sanishvili,S. Beasley,T. Skarina,D. Glesne,A. Joachimiak,A. Edwards,A. Savchenko The crystal structure of Escherichia coli MoaB suggests a probable role in molybdenum cofactor synthesis. J. Biol. Chem. 2004
Interaction RegulatedBy Rv3286c yamir.moreno IEP Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Citation Functional analysis of molybdopterin biosynthesis in mycobacteria identifies a fused molybdopterin synthase in Mycobacterium tuberculosis. authors,MJ. Williams,BD. Kana,V. Mizrahi J. Bacteriol. 2011 mwilliams 20971904 Expression in M. smegmatis moaE mutant restores MoCo biosynthesis
Citation In silico reconstruction of the metabolic pathways of Lactobacillus plantarum: comparing predictions of nutrient requirements with those from growth experiments. authors,B. Teusink,FH. van Enckevort,C. Francke,A. Wiersma,A. Wegkamp,EJ. Smid,RJ. Siezen Appl. Environ. Microbiol. 2005 jjmcfadden 16269766 Inferred from direct assay
Other EC: jjmcfadden Inferred from direct assayauthors,B. Teusink,FH. van Enckevort,C. Francke,A. Wiersma,A. Wegkamp,EJ. Smid,RJ. Siezen In silico reconstruction of the metabolic pathways of Lactobacillus plantarum: comparing predictions of nutrient requirements with those from growth experiments. Appl. Environ. Microbiol. 2005