TB Genome Annotation Portal

Rv0860 (fadB)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: 3-hydroxyacyl-CoA dehydrogenase/enoyl-CoA hydratase/3-hydroxybutyryl-CoA epimerase
  • REFSEQ: fatty oxidation protein FadB
  • PATRIC: Enoyl-CoA hydratase [isoleucine degradation] (EC 4.2.1.17) / 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35) / 3-hydroxybutyryl-CoA epimerase (EC 5.1.2.3)
  • TUBERCULIST: Probable fatty oxidation protein FadB
  • NCBI: Probable fatty oxidation protein FadB
  • updated information (H37Rv4):
    • gene name: fadB
    • function:
    • reference:
• Type: Not Target
• Start: 956293
• End: 958455
• Operon:


• Trans-membrane region:
  
• Role: I.A.3 - Fatty acids
• GO terms:
  • GO:0055114 - oxidation-reduction process (Uniprot)
  • GO:0016491 - oxidoreductase activity (Uniprot)
  • GO:0008152 - metabolic process (Uniprot)
  • GO:0006635 - fatty acid beta-oxidation (Uniprot)
  • GO:0006631 - fatty acid metabolic process (Uniprot)
  • GO:0006629 - lipid metabolic process (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005829 - cytosol (Uniprot)
  • GO:0005618 - cell wall (Uniprot)
  • GO:0003857 - 3-hydroxyacyl-CoA dehydrogenase activity (Uniprot)
  • GO:0003824 - catalytic activity (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • NAD[c] + 22HYDROXY3OXOCHOL4EN24OYL_COA[c] -> H[c] + NADH[c] + 3_22DIOXOCHOL4EN24OYL_COA[c]
  • NAD[c] + 24HYDROXY3OXOCHOLEST4EN26OYL_COA[c] -> H[c] + NADH[c] + 3_24DIOXOCHOLEST4EN26OYL_COA[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure: 4b3h, 4b3i, 4b3j
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  4B3J	100%	MYCOBACTERIUM TUBERCULOSIS	Crystal structure of Mycobacterium tuberculosis fatty acid beta- oxidation complex with CoenzymeA bound at the hydratase and thiolase active sites
  4B3I	100%	MYCOBACTERIUM TUBERCULOSIS	Crystal structure of Mycobacterium tuberculosis fatty acid beta- oxidation complex with CoenzymeA bound at the hydratase active sites
  4B3H	100%	MYCOBACTERIUM TUBERCULOSIS	Crystal structure of Mycobacterium tuberculosis fatty acid beta- oxidation complex
  4PZE	38%	Ralstonia eutropha H16	Crystal structure of (S)-3-hydroxybutyryl-CoA dehydrogenase PaaH1 in complex with acetoacetyl-CoA
  4PZD	38%	Ralstonia eutropha H16	Crystal structure of (S)-3-hydroxybutyryl-CoA dehydrogenase PaaH1 in complex with NAD+
  4PZC	38%	Ralstonia eutropha H16	Crystal structure of (S)-3-hydroxybutyryl-CoA dehydrogenase PaaH1 from Ralstonia eutropha
  5ZAI	37%	Metallosphaera sedula	Crystal structure of 3-Hydroxypropionyl-CoA dehydratase from Metallosphaera sedula
  6ACQ	36%	Clostridium acetobutylicum	Crystal structure of (S)-3-hydroxybutyryl-CoA dehydrogenase from Clostridium acetobutylicum, apo form
  6AA8	36%	Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787)	Crystal structure of (S)-3-hydroxybutyryl-coenzymeA dehydrogenase from Clostridium acetobutylicum complexed with NAD+
  3KQF	35%	Bacillus anthracis	1.8 Angstrom Resolution Crystal Structure of Enoyl-CoA Hydratase from Bacillus anthracis.

• Links to additional information on fadB:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.224 (from Jeremy Rock's lab)
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology
  • KEGG - nucleotide and amino acid sequences of gene

Amino Acid Sequence

MPDNTIQWDKDADGIVTLTMDDPSGSTNVMNEAYIESMGKAVDRLVAEKDSITGVVVASAKKTFFAGGDVKTMIQARPEDAGDVFNTVETIKRQLRTLET
LGKPVVAAINGAALGGGLEIALACHHRIAADVKGSQLGLPEVTLGLLPGGGGVTRTVRMFGIQNAFVSVLAQGTRFKPAKAKEIGLVDELVATVEELVPA
AKAWIKEELKANPDGAGVQPWDKKGYKMPGGTPSSPGLAAILPSFPSNLRKQLKGAPMPAPRAILAAAVEGAQVDFDTASRIESRYFASLVTGQVAKNMM
QAFFFDLQAINAGGSRPEGIGKTPIKRIGVLGAGMMGAGIAYVSAKAGYEVVLKDVSLEAAAKGKGYSEKLEAKALERGRTTQERSDALLARITPTADAA
DFKGVDFVIEAVFENQELKHKVFGEIEDIVEPNAILGSNTSTLPITGLATGVKRQEDFIGIHFFSPVDKMPLVEIIKGEKTSDEALARVFDYTLAIGKTP
IVVNDSRGFFTSRVIGTFVNEALAMLGEGVEPASIEQAGSQAGYPAPPLQLSDELNLELMHKIAVATRKGVEDAGGTYQPHPAEAVVEKMIELGRSGRLK
GAGFYEYADGKRSGLWPGLRETFKSGSSQPPLQDMIDRMLFAEALETQKCLDEGVLTSTADANIGSIMGIGFPPWTGGSAQFIVGYSGPAGTGKAAFVAR
ARELAAAYGDRFLPPESLLS

Additional Information