Rv0844c (narL)
Current annotations:
TBCAP: (community-based annotations - see table at bottom of page )
TBDB: two-component system NarL family nitrate/nitrite response regulator NarL
REFSEQ: nitrate/nitrite response transcriptional regulatory protein NarL
PATRIC: DNA-binding response regulator LuxR family
TUBERCULIST: Possible nitrate/nitrite response transcriptional regulatory protein NarL
NCBI: Possible nitrate/nitrite response transcriptional regulatory protein NarL
updated information (H37Rv4):
gene name: narL
function:
reference:
Coordinates in H37Rv: 940456 - 941106
Gene length: 651 bp (with stop codon), 216 aa (without stop codon)
Operon:
Trans-membrane region:
Role: I.J.2 - Two component systems
GO terms:
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure: 3eul
Search for Latest Homologs in PDB
Top 10 Homologs in PDB (as of Apr 2026): PDB aa ident species PDB title 3EUL 100% Mycobacterium tuberculosis Structure of the signal receiver domain of the putative response regulator NarL from Mycobacterium tuberculosis 4WSZ 45% None Crystal structure of the DNA binding domains of wild type LiaR from E. faecalis 4WUL 43% None Crystal structure of E. faecalis DNA binding domain LiaRD191N complexed with 26bp DNA 4WUH 43% Enterococcus faecalis S613 Crystal structure of E. faecalis DNA binding domain LiaR wild type complexed with 22bp DNA 4WU4 43% None Crystal structure of E. faecalis DNA binding domain LiaRD191N complexed with 22bp DNA 4WT0 43% None Crystal structure of the DNA binding domains of LiaRD191N from E. faecalis 7VE5 41% Staphylococcus aureus C-terminal domain of VraR 7VE4 41% Staphylococcus aureus C-terminal domain of VraR 3CLO 41% Bacteroides thetaiotaomicron VPI-5482 Crystal structure of putative transcriptional regulator containing a LuxR DNA binding domain (NP_811094.1) from Bacteroides thetaiotaomicron VPI-5482 at 2.04 A resolution 7ESG 40% Schistosoma japonicum Crystal structure of Haloarcula marismortui CheB with Glutathione S-transferase expression tag
Links to additional information on narL:
Amino Acid Sequence
MSNPQPEKVRVVVGDDHPLFREGVVRALSLSGSVNVVGEADDGAAALELIKAHLPDVALLDYRMPGMDGAQVAAAVRSYELPTRVLLISAHDEPAIVYQA
LQQGAAGFLLKDSTRTEIVKAVLDCAKGRDVVAPSLVGGLAGEIRQRAAPVAPVLSAREREVLNRIACGQSIPAIAAELYVAPSTVKTHVQRLYEKLGVS
DRAAAVAEAMRQRLLD
(
Nucleotide sequence available on
KEGG )
Additional Information
MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb
TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions
Rv0844c/narL,
gene len: 650 bp, num TA sites: 10
condition dataset call medium method notes
in-vitro DeJesus 2017 mBio non-essential 7H9 HMM fully saturated, 14 TnSeq libraries combined
in-vitro Sassetti 2003 Mol Micro non-essential 7H9 TRASH essential if hybridization ratio<0.2
in-vivo (mice) Sassetti 2003 PNAS non-essential BL6 mice TRASH essential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol) Griffin 2011 PPath non-essential M9 minimal+glycerol Gumbel 2 replicates; Padj<0.05
in-vitro (cholesterol) Griffin 2011 PPath non-essential M9 minimal+cholesterol Gumbel 3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPath NO (LFC=-0.53) cholesterol vs glycerol resampling-SR YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitro Smith 2022 eLife non-essential 7H9 HMM 6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice) Smith 2022 eLife non-essential BL6 mice HMM 6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in mice Smith 2022 eLife NO (LFC=-0.325) in-vivo vs in-vitro ZINB YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal) Minato 2019 mSys non-essential minimal medium HMM
in-vitro (YM rich medium) Minato 2019 mSys non-essential YM rich medium HMM 7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich medium Minato 2019 mSys NO (LFC=-0.7) YM rich vs minimal medium resampling
Analysis of Positive Selection in Clinical Isolates
*new*
data from Culviner et al (2025) (55,259 Mtb clinical isolates)
overall pN/pS for Rv0844c: 0.819011647
lineage-specific pN/pS in L1: 0.580048711
lineage-specific pN/pS in L2: 1.04782993
lineage-specific pN/pS in L3: 1.218102294
lineage-specific pN/pS in L4: 0.795010499
Analysis of dN/dS (omega) in a global collection of 10k Mtb clinical isolates using GenomegaMap (Window model)
clinical isolates collection: global set of 10,626 Mtb genomes
In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.
global set of 10,626 Mtb clinical isolates
under significant positive selection? NO
omega peak height (95%CI lower bound) 1.3 (0.67)
codons under selection
omega plots
genetic variants* link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"
TnSeq Data No data currently available.
No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
No Proteomic data currently available for this Target.
Regulatory Relationships from Systems Biology
BioCyc
Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology )
NOTE:
see table of TFOE interactions below
Interactions based on ChIPSeq data
RNA processing and modification
Energy production and conversion
Chromatin structure and dynamics
Amino acid transport and metabolism
Cell cycle control, cell division, chromosome partitioning
Carbohydrate transport and metabolism
Nucleotide transport and metabolism
Lipid transport and metabolism
Coenzyme transport and metabolism
Translation, ribosomal structure and biogenesis
Cell wall/membrane/envelope biogenesis
Replication, recombination and repair
Posttranslational modification, protein turnover, chaperones
Secondary metabolites biosynthesis, transport and catabolism
Inorganic ion transport and metabolism
General function prediction only
Intracellular trafficking, secretion, and vesicular transport
Signal transduction mechanisms
Differentially expressed as result of RNASeq in glycerol environment (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
Conditionally essential as result of TNSeq (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
Binds To:
Bound By:
No bindings from other targets were found.
Binds To:
No bindings to other targets were found.
Bound By:
No bindings to other targets were found.
TFOE = Transcription Factor Over-Expression study
significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01
gene dysregulated by OE of LFC
Rv0844c/narL Rv0844c/narL 1.77
Upregulates:
Upregulated by:
Downregulates:
Does not downregulate other genes.
Downregulated by:
Not downregulated by other genes.
Property Value Creator Evidence PMID Comment
Interaction Signaling Rv0845 hibeeluck NAS Gene neighbourhoodT. Parish, DA. Smith et al. Deletion of two-component regulatory systems increases the virulence of Mycobacterium tuberculosis. Infect. Immun. 2003
Citation The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008 yamir.moreno ISO 18985025 E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
Interaction Regulates Rv0529 yamir.moreno ISO E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008 yamir.moreno ISO 18985025 E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
Interaction Regulates Rv1677 yamir.moreno ISO E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008 yamir.moreno ISO 18985025 E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
Interaction Regulates Rv3547 yamir.moreno ISO E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Citation Evolutionary dynamics of prokaryotic transcriptional regulatory networks. authors,M. Madan Babu,SA. Teichmann,L. Aravind J. Mol. Biol. 2006 yamir.moreno ISO 16530225 E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
Interaction Regulates Rv0529 yamir.moreno ISO E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Citation Evolutionary dynamics of prokaryotic transcriptional regulatory networks. authors,M. Madan Babu,SA. Teichmann,L. Aravind J. Mol. Biol. 2006 yamir.moreno ISO 16530225 E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
Interaction Regulates Rv1677 yamir.moreno ISO E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Citation Evolutionary dynamics of prokaryotic transcriptional regulatory networks. authors,M. Madan Babu,SA. Teichmann,L. Aravind J. Mol. Biol. 2006 yamir.moreno ISO 16530225 E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.
Interaction Regulates Rv3547 yamir.moreno ISO E.coli orthology based inference. Orthologous pair regulator-target found in E.coli.authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006