TB Genome Annotation Portal

Rv0830 (-)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: hypothetical protein
  • REFSEQ: hypothetical protein
  • PATRIC: O-Methyltransferase involved in polyketide biosynthesis
  • TUBERCULIST: Possible S-adenosylmethionine-dependent methyltransferase
  • NCBI: Possible S-adenosylmethionine-dependent methyltransferase
  • updated information (H37Rv4):
    • gene name: -
    • function:
    • reference:
• Type: Not Target
• Start: 921970
• End: 922875
• Operon:


• Trans-membrane region:
  
• Role: V - Conserved hypotheticals
• GO terms:
  • GO:0032259 - methylation (Uniprot)
  • GO:0016740 - transferase activity (Uniprot)
  • GO:0008168 - methyltransferase activity (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005618 - cell wall (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  6ID6	51%	Mycobacterium tuberculosis H37Rv	Crystal structure of Rv0731c from Mycobacterium tuberculosis at 1.63 Angstroms.
  2UYQ	46%	MYCOBACTERIUM LEPRAE	Crystal structure of ML2640c from Mycobacterium leprae in complex with S-adenosylmethionine
  2UYO	46%	MYCOBACTERIUM LEPRAE	Crystal structure of ML2640c from Mycobacterium leprae in an hexagonal crystal form
  2CKD	46%	MYCOBACTERIUM LEPRAE	Crystal structure of ML2640 from Mycobacterium leprae

• Links to additional information on Rv0830:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 1.269 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • BioCyc
  • Systems Biology
  • Mycobrowser
  • PATRIC

Amino Acid Sequence

MVRADRDRWDLATSVGATATMVAAQRALAADPRYALIDDPYAAPLVRAVGMDVYTRLVDWQIPVEGDSEFDPQRMATGMACRTRFFDQFFLDATHSGIGQ
FVILASGLDARAYRLAWPVGSIVYEVDMPEVIEFKTATLSDLGAEPATERRTVAVDLRDDWATALQTAGFDPKVPAAWSAEGLLVYLPVEAQDALFDNIT
ALSAPGSRLAFEFVPDTAIFADERWRNYHNRMSELGFDIDLNELVYHGQRGHVLDYLTRDGWQTSALTVTQLYEANGFAYPDDELATAFADLTYSSATLM
R

Additional Information