TB Genome Annotation Portal

Rv0819 (mshD)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: mycothiol acetyltransferase
  • REFSEQ: hypothetical protein
  • PATRIC: Acetyl-CoA:Cys-GlcN-Ins acetyltransferase mycothiol synthase MshD
  • TUBERCULIST: GCN5-related N-acetyltransferase MshD
  • NCBI: GCN5-related N-acetyltransferase, MshD
  • updated information (H37Rv4):
    • gene name: mshD
    • function:
    • reference:
• Type: Essential
• Start: 911736
• End: 912683
• Operon:


• Trans-membrane region:
  
• Role: V - Conserved hypotheticals
• GO terms:
  • GO:0071468 - cellular response to acidic pH (Uniprot)
  • GO:0070301 - cellular response to hydrogen peroxide (Uniprot)
  • GO:0044119 - growth of symbiont in host cell (Uniprot)
  • GO:0035447 - mycothiol synthase activity (Uniprot)
  • GO:0016747 - transferase activity, transferring acyl groups other than amino-acyl groups (Uniprot)
  • GO:0016746 - transferase activity, transferring acyl groups (Uniprot)
  • GO:0016740 - transferase activity (Uniprot)
  • GO:0010126 - mycothiol metabolic process (Uniprot)
  • GO:0010125 - mycothiol biosynthetic process (Uniprot)
  • GO:0008080 - N-acetyltransferase activity (Uniprot)
  • GO:0005829 - cytosol (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • ACCOA[c] + CYS_NG_INS[c] -> COA[c] + MYCOTHIOL[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure: 1p0h, 1ozp, 2c27
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  2C27	99%	MYCOBACTERIUM TUBERCULOSIS	The Structure of Mycothiol Synthase in Complex with des- AcetylMycothiol and CoenzymeA.
  1P0H	99%	Mycobacterium tuberculosis	Crystal Structure of Rv0819 from Mycobacterium Tuberculosis MshD-Mycothiol Synthase Coenzyme A Complex
  1OZP	99%	Mycobacterium tuberculosis	Crystal Structure of Rv0819 from Mycobacterium tuberculosis MshD-Mycothiol Synthase Acetyl-Coenzyme A Complex.

• Links to additional information on mshD:
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -0.1 (from Jeremy Rock's lab)

Amino Acid Sequence

VTALDWRSALTADEQRSVRALVTATTAVDGVAPVGEQVLRELGQQRTEHLLVAGSRPGGPIIGYLNLSPPRGAGGAMAELVVHPQSRRRGIGTAMARAAL
AKTAGRNQFWAHGTLDPARATASALGLVGVRELIQMRRPLRDIPEPTIPDGVVIRTYAGTSDDAELLRVNNAAFAGHPEQGGWTAVQLAERRGEAWFDPD
GLILAFGDSPRERPGRLLGFHWTKVHPDHPGLGEVYVLGVDPAAQRRGLGQMLTSIGIVSLARRLGGRKTLDPAVEPAVLLYVESDNVAAVRTYQSLGFT
TYSVDTAYALAGTDN

Additional Information

Analysis of Positive Selection in Clinical Isolates *new*

• Analysis of dN/dS (omega) in two collections of Mtb clinical isolates using GenomegaMap (Window model) (see description of methods)
  • Moldova: 2,057 clinical isolates
  • global set: 5,195 clinical isolates from 15 other countries
• In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
• A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.

	Moldova (2,057)	global set (5,195)
under significant positive selection?	NO	NO
omega peak height (95%CI lower bound)	1.68 (0.38)	1.84 (0.78)
codons under selection
omega plots
genetic variants*	link	link
statistics at each codon	link	link