Rv0805 (-)
Current annotations:
TBCAP: (community-based annotations - see table at bottom of page )
TBDB: hypothetical protein
REFSEQ: hypothetical protein
PATRIC: 3'5'-cyclic-nucleotide phosphodiesterase (EC 3.1.4.17)
TUBERCULIST: Class III cyclic nucleotide phosphodiesterase (cNMP PDE)
NCBI: Class III cyclic nucleotide phosphodiesterase (cNMP PDE)
updated information (H37Rv4):
gene name: -
function: cAMP phosphodiesterase; propionate metabolism; regulated by PhoP; stress response
reference: McDowell (2023) PMID: 36760076; Khan (2024) PMID: 38739431
Coordinates in H37Rv: 898831 - 899787
Gene length: 957 bp (with stop codon), 318 aa (without stop codon)
Operon:
Trans-membrane region:
Role: V - Conserved hypotheticals
GO terms:
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure: 3ib7 , 2hyp , 2hy1 , 2hyo , 3ib8
Search for Latest Homologs in PDB
Top 10 Homologs in PDB (as of Apr 2026): PDB aa ident species PDB title 3IB8 100% Mycobacterium tuberculosis Crystal structure of full length Rv0805 in complex with 5'-AMP 3IB7 100% Mycobacterium tuberculosis Crystal structure of full length Rv0805 2HY1 100% Mycobacterium tuberculosis Crystal structure of Rv0805 2HYP 99% Mycobacterium tuberculosis Crystal structure of Rv0805 D66A mutant 2HYO 99% Mycobacterium tuberculosis Crystal structure of Rv0805 N97A mutant
Links to additional information on Rv0805:
Amino Acid Sequence
VHRLRAAEHPRPDYVLLHISDTHLIGGDRRLYGAVDADDRLGELLEQLNQSGLRPDAIVFTGDLADKGEPAAYRKLRGLVEPFAAQLGAELVWVMGNHDD
RAELRKFLLDEAPSMAPLDRVCMIDGLRIIVLDTSVPGHHHGEIRASQLGWLAEELATPAPDGTILALHHPPIPSVLDMAVTVELRDQAALGRVLRGTDV
RAILAGHLHYSTNATFVGIPVSVASATCYTQDLTVAAGGTRGRDGAQGCNLVHVYPDTVVHSVIPLGGGETVGTFVSPGQARRKIAESGIFIEPSRRDSL
FKHPPMVLTSSAPRSPVD
(
Nucleotide sequence available on
KEGG )
Additional Information
MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb
TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions
Rv0805/-,
gene len: 956 bp, num TA sites: 18
condition dataset call medium method notes
in-vitro DeJesus 2017 mBio non-essential 7H9 HMM fully saturated, 14 TnSeq libraries combined
in-vitro Sassetti 2003 Mol Micro no data 7H9 TRASH essential if hybridization ratio<0.2
in-vivo (mice) Sassetti 2003 PNAS no data BL6 mice TRASH essential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol) Griffin 2011 PPath non-essential M9 minimal+glycerol Gumbel 2 replicates; Padj<0.05
in-vitro (cholesterol) Griffin 2011 PPath uncertain M9 minimal+cholesterol Gumbel 3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPath YES (LFC=-2.75) cholesterol vs glycerol resampling-SR YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitro Smith 2022 eLife non-essential 7H9 HMM 6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice) Smith 2022 eLife non-essential BL6 mice HMM 6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in mice Smith 2022 eLife NO (LFC=0.066) in-vivo vs in-vitro ZINB YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal) Minato 2019 mSys non-essential minimal medium HMM
in-vitro (YM rich medium) Minato 2019 mSys growth advantage YM rich medium HMM 7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich medium Minato 2019 mSys NO (LFC=1.25) YM rich vs minimal medium resampling
Analysis of Positive Selection in Clinical Isolates
*new*
data from Culviner et al (2025) (55,259 Mtb clinical isolates)
overall pN/pS for Rv0805: 0.760357517
lineage-specific pN/pS in L1: 0.8526358
lineage-specific pN/pS in L2: 0.728748547
lineage-specific pN/pS in L3: 1.008776924
lineage-specific pN/pS in L4: 0.663878885
Analysis of dN/dS (omega) in a global collection of 10k Mtb clinical isolates using GenomegaMap (Window model)
clinical isolates collection: global set of 10,626 Mtb genomes
In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.
global set of 10,626 Mtb clinical isolates
under significant positive selection? NO
omega peak height (95%CI lower bound) 1.95 (0.73)
codons under selection
omega plots
genetic variants* link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"
TnSeq Data No data currently available.
No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
No Proteomic data currently available for this Target.
Regulatory Relationships from Systems Biology
BioCyc
Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology )
NOTE:
see table of TFOE interactions below
Interactions based on ChIPSeq data
RNA processing and modification
Energy production and conversion
Chromatin structure and dynamics
Amino acid transport and metabolism
Cell cycle control, cell division, chromosome partitioning
Carbohydrate transport and metabolism
Nucleotide transport and metabolism
Lipid transport and metabolism
Coenzyme transport and metabolism
Translation, ribosomal structure and biogenesis
Cell wall/membrane/envelope biogenesis
Replication, recombination and repair
Posttranslational modification, protein turnover, chaperones
Secondary metabolites biosynthesis, transport and catabolism
Inorganic ion transport and metabolism
General function prediction only
Intracellular trafficking, secretion, and vesicular transport
Signal transduction mechanisms
Differentially expressed as result of RNASeq in glycerol environment (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
Conditionally essential as result of TNSeq (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
Binds To:
No bindings to other targets were found.
Bound By:
No bindings from other targets were found.
Binds To:
No bindings to other targets were found.
Bound By:
TFOE = Transcription Factor Over-Expression study
significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01
no significant interactions found
Upregulates:
Does not upregulate other genes.
Upregulated by:
Not upregulated by other genes.
Downregulates:
Does not downregulate other genes.
Downregulated by:
Not downregulated by other genes.
Property Value Creator Evidence PMID Comment
Citation The Rv0805 gene from Mycobacterium tuberculosis encodes a 3',5'-cyclic nucleotide phosphodiesterase: biochemical and mutational analysis. AR. Shenoy, N. Sreenath et al. Biochemistry 2005 njamshidi IDA 16313172 PMID: 16313172
Term EC:3.1.4.17 3',5'-cyclic-nucleotide phosphodiesterase. - IDA njamshidi IDA 16313172 PMID: 16313172AR. Shenoy, N. Sreenath et al. The Rv0805 gene from Mycobacterium tuberculosis encodes a 3',5'-cyclic nucleotide phosphodiesterase: biochemical and mutational analysis. Biochemistry 2005
Term TBRXN:PDE4 3',5'-cyclic-nucleotide phosphodiesterase - IDA njamshidi IDA 16313172 PMID: 16313172AR. Shenoy, N. Sreenath et al. The Rv0805 gene from Mycobacterium tuberculosis encodes a 3',5'-cyclic nucleotide phosphodiesterase: biochemical and mutational analysis. Biochemistry 2005
Citation The Rv0805 gene from Mycobacterium tuberculosis encodes a 3',5'-cyclic nucleotide phosphodiesterase: biochemical and mutational analysis. AR. Shenoy, N. Sreenath et al. Biochemistry 2005 njamshidi ISS 16313172 PMID: 16313172
Term EC:3.1.4.17 3',5'-cyclic-nucleotide phosphodiesterase. - ISS njamshidi ISS 16313172 PMID: 16313172AR. Shenoy, N. Sreenath et al. The Rv0805 gene from Mycobacterium tuberculosis encodes a 3',5'-cyclic nucleotide phosphodiesterase: biochemical and mutational analysis. Biochemistry 2005
Term TBRXN:PDE4 3',5'-cyclic-nucleotide phosphodiesterase - ISS njamshidi ISS 16313172 PMID: 16313172AR. Shenoy, N. Sreenath et al. The Rv0805 gene from Mycobacterium tuberculosis encodes a 3',5'-cyclic nucleotide phosphodiesterase: biochemical and mutational analysis. Biochemistry 2005
Citation The Rv0805 gene from Mycobacterium tuberculosis encodes a 3',5'-cyclic nucleotide phosphodiesterase: biochemical and mutational analysis. AR. Shenoy, N. Sreenath et al. Biochemistry 2005 njamshidi IDA 16313172 PMID: 16313172 should be able to do 35cgmp also add PDE4 (rxn) if cgmp producing reactions found
Term EC:3.1.4.17 3',5'-cyclic-nucleotide phosphodiesterase. - IDA njamshidi IDA 16313172 PMID: 16313172 should be able to do 35cgmp also add PDE4 (rxn) if cgmp producing reactions foundAR. Shenoy, N. Sreenath et al. The Rv0805 gene from Mycobacterium tuberculosis encodes a 3',5'-cyclic nucleotide phosphodiesterase: biochemical and mutational analysis. Biochemistry 2005
Term TBRXN:PDE1 3',5'-cyclic-nucleotide phosphodiesterase - IDA njamshidi IDA 16313172 PMID: 16313172 should be able to do 35cgmp also add PDE4 (rxn) if cgmp producing reactions foundAR. Shenoy, N. Sreenath et al. The Rv0805 gene from Mycobacterium tuberculosis encodes a 3',5'-cyclic nucleotide phosphodiesterase: biochemical and mutational analysis. Biochemistry 2005
Citation The Rv0805 gene from Mycobacterium tuberculosis encodes a 3',5'-cyclic nucleotide phosphodiesterase: biochemical and mutational analysis. AR. Shenoy, N. Sreenath et al. Biochemistry 2005 njamshidi ISS 16313172 PMID: 16313172 should be able to do 35cgmp also add PDE4 (rxn) if cgmp producing reactions found
Term EC:3.1.4.17 3',5'-cyclic-nucleotide phosphodiesterase. - ISS njamshidi ISS 16313172 PMID: 16313172 should be able to do 35cgmp also add PDE4 (rxn) if cgmp producing reactions foundAR. Shenoy, N. Sreenath et al. The Rv0805 gene from Mycobacterium tuberculosis encodes a 3',5'-cyclic nucleotide phosphodiesterase: biochemical and mutational analysis. Biochemistry 2005
Term TBRXN:PDE1 3',5'-cyclic-nucleotide phosphodiesterase - ISS njamshidi ISS 16313172 PMID: 16313172 should be able to do 35cgmp also add PDE4 (rxn) if cgmp producing reactions foundAR. Shenoy, N. Sreenath et al. The Rv0805 gene from Mycobacterium tuberculosis encodes a 3',5'-cyclic nucleotide phosphodiesterase: biochemical and mutational analysis. Biochemistry 2005
Interaction RegulatedBy Rv0348 yamir.moreno IEP Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction RegulatedBy Rv3676 yamir.moreno TAS Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008