TB Genome Annotation Portal

Rv0805 (-)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: hypothetical protein
  • REFSEQ: hypothetical protein
  • PATRIC: 3'5'-cyclic-nucleotide phosphodiesterase (EC 3.1.4.17)
  • TUBERCULIST: Class III cyclic nucleotide phosphodiesterase (cNMP PDE)
  • NCBI: Class III cyclic nucleotide phosphodiesterase (cNMP PDE)
  • updated information (H37Rv4):
    • gene name: -
    • function: cAMP phosphodiesterase; regulated by PhoP
    • reference: Khan (2024) PMID: 38739431
• Type: Conditional
• Start: 898831
• End: 899787
• Operon:


• Trans-membrane region:
  
• Role: V - Conserved hypotheticals
• GO terms:
  • GO:0046872 - metal ion binding (Uniprot)
  • GO:0042545 - cell wall modification (Uniprot)
  • GO:0042301 - phosphate ion binding (Uniprot)
  • GO:0030145 - manganese ion binding (Uniprot)
  • GO:0016791 - phosphatase activity (Uniprot)
  • GO:0016787 - hydrolase activity (Uniprot)
  • GO:0016311 - dephosphorylation (Uniprot)
  • GO:0016020 - membrane (Uniprot)
  • GO:0009405 - pathogenesis (Uniprot)
  • GO:0008663 - 2',3'-cyclic-nucleotide 2'-phosphodiesterase activity (Uniprot)
  • GO:0008199 - ferric iron binding (Uniprot)
  • GO:0006198 - cAMP catabolic process (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005737 - cytoplasm (Uniprot)
  • GO:0005618 - cell wall (Uniprot)
  • GO:0005576 - extracellular region (Uniprot)
  • GO:0005515 - protein binding (Uniprot)
  • GO:0005506 - iron ion binding (Uniprot)
  • GO:0004115 - 3',5'-cyclic-AMP phosphodiesterase activity (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • cGMP[c] -> GMP[c]
  • cAMP[c] -> AMP[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure: 3ib7, 2hyp, 2hy1, 2hyo, 3ib8
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  3IB8	100%	Mycobacterium tuberculosis	Crystal structure of full length Rv0805 in complex with 5'-AMP
  3IB7	100%	Mycobacterium tuberculosis	Crystal structure of full length Rv0805
  2HY1	100%	Mycobacterium tuberculosis	Crystal structure of Rv0805
  2HYP	99%	Mycobacterium tuberculosis	Crystal structure of Rv0805 D66A mutant
  2HYO	99%	Mycobacterium tuberculosis	Crystal structure of Rv0805 N97A mutant

• Links to additional information on Rv0805:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 1.537 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

VHRLRAAEHPRPDYVLLHISDTHLIGGDRRLYGAVDADDRLGELLEQLNQSGLRPDAIVFTGDLADKGEPAAYRKLRGLVEPFAAQLGAELVWVMGNHDD
RAELRKFLLDEAPSMAPLDRVCMIDGLRIIVLDTSVPGHHHGEIRASQLGWLAEELATPAPDGTILALHHPPIPSVLDMAVTVELRDQAALGRVLRGTDV
RAILAGHLHYSTNATFVGIPVSVASATCYTQDLTVAAGGTRGRDGAQGCNLVHVYPDTVVHSVIPLGGGETVGTFVSPGQARRKIAESGIFIEPSRRDSL
FKHPPMVLTSSAPRSPVD

Additional Information