TB Genome Annotation Portal

Rv0773c (ggtA)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: gamma-glutamyltransferase
  • REFSEQ: bifunctional cephalosporin acylase/gamma-glutamyltranspeptidase
  • PATRIC: Gamma-glutamyltranspeptidase (EC 2.3.2.2)
  • TUBERCULIST: Probable bifunctional acylase GgtA: cephalosporin acylase (GL-7ACA acylase) + gamma-glutamyltranspeptidase (GGT)
  • NCBI: Probable bifunctional acylase GgtA: cephalosporin acylase (GL-7ACA acylase) + gamma-glutamyltranspeptidase (GGT)
  • updated information (H37Rv4):
    • gene name: ggtA
    • function:
    • reference:
• Type: Not Target
• Start: 865851
• End: 867389
• Operon:


• Trans-membrane region:
  
• Role: I.G.10 - Thioredoxin, glutaredoxin and mycothiol
• GO terms:
  • GO:0036374 - glutathione hydrolase activity (Uniprot)
  • GO:0006751 - glutathione catabolic process (Uniprot)
  • GO:0006508 - proteolysis (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • ALA[c] + GTHRD[c] -> CGLY[c] + GLUALA[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  2NLZ	50%	Bacillus halodurans	Crystal structure of cephalosporin acylase from Bacillus halodurans
  5HFT	37%	Klebsiella pneumoniae subsp. pneumoniae	Crystal structure of HpxW
  5HFT	35%	Klebsiella pneumoniae subsp. pneumoniae	Crystal structure of HpxW

• Links to additional information on ggtA:
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 1.133 (from Jeremy Rock's lab)
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MPILATNVVCTSQPLAAQAGLRMLADGGNAVDAAVATAITLTVVEPVSNGIGSDAFSIVWDGQKLHGLNASGRSPSAWTPEYFGGNAVPVLGWNSVTVPG
AVSAWVELHARFGRLPFETLFEPAISYGRNGFLVSPTVAAQWAAQVPLFASQPGFADAFMPGGRAPKPGELFTFPDHAATLEKIAATNGEEFYRGELAAK
LEAHSAANGGVMRADDLAAHRVDWVDTITGTYRGYTIHQIPPNGQGIVALIALGILEHFDMSSWSVDSAESVHVQIEALKLAFADAQACVADIDYMPVHP
KRLLDKEYLRQRATLIDPKRAMPAATGIPRGGTVYLAAADAAGMMVSMIQSNYLGFGSGVVVPGTGISLHNRGSDFTVVPRHPNRVGPRKRPYHTIIPGF
VTRDGAPVMSFGVMGGMMQPQGHVQVLVRIADYGQNPQAACDGPRFRWVNGMRVSFENGFPDSTLDELRQRGHDLVAVADYSQFGSCQAIWRLDDGYLAA
SDPRRDGQAAAC

Additional Information