TB Genome Annotation Portal

Rv0758 (phoR)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: two-component system OmpR family sensor kinase
  • REFSEQ: two component system response sensor kinase membrane associated PHOR
  • PATRIC: PhoR
  • TUBERCULIST: Possible two component system response sensor kinase membrane associated PhoR
  • NCBI: Possible two component system response sensor kinase membrane associated PhoR
  • updated information (H37Rv4):
    • gene name: phoR
    • function:
    • reference:
• Type: Not Target
• Start: 852396
• End: 853853
• Operon:


• Trans-membrane region:
  
• Role: I.J.2 - Two component systems
• GO terms:
  • GO:0023014 - signal transduction by protein phosphorylation (Uniprot)
  • GO:0016772 - transferase activity, transferring phosphorus-containing groups (Uniprot)
  • GO:0016740 - transferase activity (Uniprot)
  • GO:0016310 - phosphorylation (Uniprot)
  • GO:0016301 - kinase activity (Uniprot)
  • GO:0016021 - integral component of membrane (Uniprot)
  • GO:0016020 - membrane (Uniprot)
  • GO:0007165 - signal transduction (Uniprot)
  • GO:0005622 - intracellular (Uniprot)
  • GO:0005524 - ATP binding (Uniprot)
  • GO:0004871 - signal transducer activity (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
  • GO:0000160 - phosphorelay signal transduction system (Uniprot)
  • GO:0000155 - phosphorelay sensor kinase activity (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • AHTD[c] -> 3 PI[c] + DHP[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  5UKY	98%	Mycobacterium tuberculosis	DHp domain of PhoR of M. tuberculosis - native data
  5UKV	98%	Mycobacterium tuberculosis	DHp domain of PhoR of M. tuberculosis - SeMet
  6BLK	40%	Mycobacterium hassiacum (strain DSM 44199 / CIP 105218 / JCM 12690 / 3849)	Mycobacterial sensor histidine kinase MprB
  3SL2	38%	Bacillus subtilis	ATP Forms a Stable Complex with the Essential Histidine Kinase WalK (YycG) Domain
  1BXD	36%	Escherichia coli BL21(DE3)	NMR STRUCTURE OF THE HISTIDINE KINASE DOMAIN OF THE E. COLI OSMOSENSOR ENVZ
  1R62	36%	Escherichia coli	Crystal structure of the C-terminal Domain of the Two-Component System Transmitter Protein NRII (NtrB)
  4JAU	35%	Thermotoga maritima	Structural basis of a rationally rewired protein-protein interface (HK853mutant A268V, A271G, T275M, V294T and D297E)
  4JAS	35%	Thermotoga maritima	Structural basis of a rationally rewired protein-protein interface (HK853mutant A268V, A271G, T275M, V294T and D297E and RR468mutant V13P, L14I, I17M and N21V)

• Links to additional information on phoR:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -0.092 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MARHLRGRLPLRVRLVAATLILVATGLVASGIAVTSMLQHRLTSRIDRVLLEEAQIWAQITLPLAPDPYPGHNPDRPPSRFYVRVISPDGQSYTALNDNT
AIPAVPANNDVGRHPTTLPSIGGSKTLWRAVSVRASDGYLTTVAIDLADVRSTVRSLVLLQVGIGSAVLVVPGVAGYAVVRRSLRPLAEFEQTAAAIGAG
QLDRRVPQWHPRTEVGRLSLALNGMLAQIQRAVASAESSAEKARDSEDRMRQFITDASHELRTPLTTIRGFAELYRQGAARDVGMLLSRIESEASRMGLL
VDDLLLLARLDAHRPLELCRVDLLALASDAAHDARAMDPKRRITLEVLDGPGTPEVLGDESRLRQVLRNLVANAIQHTPESADVTVRVGTEGDDAILEVA
DDGPGMSQEDALRVFERFYRADSSRARASGGTGLGLSIVDSLVAAHGGAVTVTTALGEGCCFRVSLPRVSDVDQLSLTPVVPGPP

Additional Information

Analysis of Positive Selection in Clinical Isolates *new*

• Analysis of dN/dS (omega) in two collections of Mtb clinical isolates using GenomegaMap (Window model) (see description of methods)
  • Moldova: 2,057 clinical isolates
  • global set: 5,195 clinical isolates from 15 other countries
• In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
• A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.

	Moldova (2,057)	global set (5,195)
under significant positive selection?	YES	YES
omega peak height (95%CI lower bound)	2.7 (1.48)	2.1 (1.3)
codons under selection	52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 159, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201	44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 56, 57, 58, 59, 60, 61, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 141, 142, 143, 144, 145, 146, 147, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, 200, 201, 264, 265, 266, 267, 268, 269, 270, 271, 272, 273, 274, 275, 276, 277, 278, 279, 280, 281, 282, 283, 288, 322, 323, 324, 325, 327, 328
omega plots
genetic variants*	link	link
statistics at each codon	link	link