TB Genome Annotation Portal

Rv0735 (sigL)

Amino Acid Sequence

VARVSGAAAAEAALMRALYDEHAAVLWRYALRLTGDAAQAEDVVQETLLRAWQHPEVIGDTARPARAWLFTVARNMIIDERRSARFRNVVGSTDQSGTPE
QSTPDEVNAALDRLLIADALAQLSAEHRAVIQRSYYRGWSTAQIATDLGIAEGTVKSRLHYAVRALRLTLQELGVTR
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv0735/sigL, gene len: 533 bp, num TA sites: 7
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBionon-essential7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Micronon-essential 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASnon-essential BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathnon-essentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathnon-essentialM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=0.21)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifenon-essential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifenon-essentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=-0.056)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysnon-essentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysnon-essentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=-0.94)YM rich vs minimal mediumresampling

Analysis of Positive Selection in Clinical Isolates *new*

global set of 10,626 Mtb clinical isolates
under significant positive selection?NO
omega peak height (95%CI lower bound)1.02 (0.49)
codons under selection
omega plotsomega plot across ORF
genetic variants*link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"



TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: see table of TFOE interactions below

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)

    TFOE = Transcription Factor Over-Expression study
    significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01

    genedysregulated by OE ofLFC
    Rv0735/sigLRv0735/sigL4.81
    Rv0735/sigLRv0576/--1.26


    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv0735 (sigL)

    PropertyValueCreatorEvidencePMIDComment
    InteractionTranscription Rv3895cshahanup86IEPCo-expression (Functional linkage)
    NC. Gey Van Pittius, J. Gamieldien et al. The ESAT-6 gene cluster of Mycobacterium tuberculosis and other high G+C Gram-positive bacteria. Genome Biol. 2001
    InteractionTranscription Rv3895cshahanup86IEPCo-expression (Functional linkage)
    MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
    InteractionRegulatory Rv2877cpriti.prietyIPIAffinity purification (Physical interaction)
    MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
    InteractionRegulatory Rv2878cpriti.prietyIPIAffinity purification (Physical interaction)
    MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
    InteractionRegulatory Rv1696salluamity1IEPCo-expression (Functional linkage)
    MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
    InteractionRegulatory Rv1665priti.prietyIEP
    E. Dainese, S. Rodrigue et al. Posttranslational regulation of Mycobacterium tuberculosis extracytoplasmic-function sigma factor sigma L and roles in virulence and in global regulation of gene expression. Infect. Immun. 2006
    InteractionRegulatory Rv1665ashwinigbhatIEP
    E. Dainese, S. Rodrigue et al. Posttranslational regulation of Mycobacterium tuberculosis extracytoplasmic-function sigma factor sigma L and roles in virulence and in global regulation of gene expression. Infect. Immun. 2006
    InteractionRegulatory Rv1661shahanup86IEPCo-expression (Functional Linkage)
    MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
    InteractionRegulatory Rv1661shahanup86IEPCo-expression (Functional Linkage)
    authors,G. Yadav,RS. Gokhale,D. Mohanty SEARCHPKS: A program for detection and analysis of polyketide synthase domains. Nucleic Acids Res. 2003
    InteractionRegulatory Rv1661vashishtrvIEPCo-expression (Functional Linkage)
    MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
    InteractionRegulatory Rv1661vashishtrvIEPCo-expression (Functional Linkage)
    authors,G. Yadav,RS. Gokhale,D. Mohanty SEARCHPKS: A program for detection and analysis of polyketide synthase domains. Nucleic Acids Res. 2003
    InteractionRegulatory Rv1660ashwinigbhatIEP
    E. Dainese, S. Rodrigue et al. Posttranslational regulation of Mycobacterium tuberculosis extracytoplasmic-function sigma factor sigma L and roles in virulence and in global regulation of gene expression. Infect. Immun. 2006
    InteractionRegulatory Rv1660priti.prietyIEP
    authors,SK. Jain,SM. Hernandez-Abanto,QJ. Cheng,P. Singh,LH. Ly,LG. Klinkenberg,NE. Morrison,PJ. Converse,E. Nuermberger,J. Grosset,DN. McMurray,PC. Karakousis,G. Lamichhane,WR. Bishai Accelerated detection of Mycobacterium tuberculosis genes essential for bacterial survival in guinea pigs, compared with mice. J. Infect. Dis. 2007
    InteractionRegulatory Rv1660priti.prietyIEP
    E. Dainese, S. Rodrigue et al. Posttranslational regulation of Mycobacterium tuberculosis extracytoplasmic-function sigma factor sigma L and roles in virulence and in global regulation of gene expression. Infect. Immun. 2006
    InteractionRegulatory Rv1660ashwinigbhatIEP
    authors,SK. Jain,SM. Hernandez-Abanto,QJ. Cheng,P. Singh,LH. Ly,LG. Klinkenberg,NE. Morrison,PJ. Converse,E. Nuermberger,J. Grosset,DN. McMurray,PC. Karakousis,G. Lamichhane,WR. Bishai Accelerated detection of Mycobacterium tuberculosis genes essential for bacterial survival in guinea pigs, compared with mice. J. Infect. Dis. 2007
    InteractionRegulatory Rv1146aparna.vchalamIDAIn vitro transcription assay
    authors,NJ. Loman,MJ. Pallen XDR-TB genome sequencing: a glimpse of the microbiology of the future. Future Microbiol 2008
    InteractionRegulatory Rv1146aparna.vchalamIDAIn vitro transcription assay
    authors,RR. Scherberger,H. Kaess,S. Brckner [Studies on the action of an anticholinergic agent in combination with a tranquilizer on gastric juice secretion in man]. Arzneimittelforschung 1975
    InteractionRegulatory Rv1145aparna.vchalamIDAIn vitro transcription assay
    XZ. Li, L. Zhang et al. Efflux pump-mediated intrinsic drug resistance in Mycobacterium smegmatis. Antimicrob. Agents Chemother. 2004
    InteractionRegulatory Rv1145aparna.vchalamIDAIn vitro transcription assay
    authors,NJ. Loman,MJ. Pallen XDR-TB genome sequencing: a glimpse of the microbiology of the future. Future Microbiol 2008
    InteractionRegulatory Rv1145aparna.vchalamIDAIn vitro transcription assay
    authors,RR. Scherberger,H. Kaess,S. Brckner [Studies on the action of an anticholinergic agent in combination with a tranquilizer on gastric juice secretion in man]. Arzneimittelforschung 1975
    InteractionRegulatory Rv1146aparna.vchalamIDAIn vitro transcription assay
    E. Dainese, S. Rodrigue et al. Posttranslational regulation of Mycobacterium tuberculosis extracytoplasmic-function sigma factor sigma L and roles in virulence and in global regulation of gene expression. Infect. Immun. 2006
    InteractionRegulatory Rv1146aparna.vchalamIDAIn vitro transcription assay
    XZ. Li, L. Zhang et al. Efflux pump-mediated intrinsic drug resistance in Mycobacterium smegmatis. Antimicrob. Agents Chemother. 2004
    InteractionRegulatory Rv1139canshula.arora1990IEPCo-expression (Functional linkage)
    authors,B. Karlmark,B. Agerup,PJ. Wistrand Renal proximal tubular acidification. Role of brush-border and cytoplasmic carbonic anhydrase. Acta Physiol. Scand. 1979
    InteractionRegulatory Rv1145aparna.vchalamIDAIn vitro transcription assay
    E. Dainese, S. Rodrigue et al. Posttranslational regulation of Mycobacterium tuberculosis extracytoplasmic-function sigma factor sigma L and roles in virulence and in global regulation of gene expression. Infect. Immun. 2006
    InteractionRegulatory Rv1138cashwinigbhatIEPCo-expression (Functional linkage)
    MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
    InteractionRegulatory Rv1139canshula.arora1990IEPCo-expression (Functional linkage)
    authors,JD. Romano,S. Michaelis Topological and mutational analysis of Saccharomyces cerevisiae Ste14p, founding member of the isoprenylcysteine carboxyl methyltransferase family. Mol. Biol. Cell 2001
    InteractionRegulatory Rv1139canshula.arora1990IEPCo-expression (Functional linkage)
    MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
    CitationThe Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. MY. Hahn, S. Raman et al. J. Bacteriol. 2005sourish10IPI16199577Yeast two-hybrid (Physical interaction)
    InteractionRegulatory Rv0736sourish10IPIYeast two-hybrid (Physical interaction)
    MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
    InteractionInhibition Rv0736vmevada102IPIYeast two-hybrid (Physical interaction)
    MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
    CitationThe Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. MY. Hahn, S. Raman et al. J. Bacteriol. 2005ahal4789IPI16199577Yeast two-hybrid (Physical interaction)
    InteractionRegulatory Rv0736ahal4789IPIYeast two-hybrid (Physical interaction)
    MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    InteractionRegulates Rv0735yamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    InteractionRegulatedBy Rv0735yamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    InteractionRegulates Rv1139cyamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    InteractionRegulates Rv1660yamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. G. Balzsi, AP. Heath et al. Mol. Syst. Biol. 2008yamir.morenoTAS18985025Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    InteractionRegulates Rv2878cyamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008

    Comments