TB Genome Annotation Portal

Rv0693 (pqqE)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: radical SAM peptide maturase mycofactocin system protein
  • REFSEQ: coenzyme PQQ synthesis protein E
  • PATRIC: Mycofactocin radical SAM maturase
  • TUBERCULIST: Probable coenzyme PQQ synthesis protein E PqqE (coenzyme PQQ synthesis protein III)
  • NCBI: Probable coenzyme PQQ synthesis protein E PqqE (coenzyme PQQ synthesis protein III)
  • updated information (H37Rv4):
    • gene name: mftC
    • function: aka MftC - mycofactocin radical-SAM maturase
    • reference: Krishnamoorty (2019) PMID: 31113891
• Type: Not Target
• Start: 792157
• End: 793332
• Operon:


• Trans-membrane region:
  
• Role: I.G.11 - Menaquinone, PQQ, ubiquinone and other terpenoids
• GO terms:
  • GO:0051539 - 4 iron, 4 sulfur cluster binding (Uniprot)
  • GO:0051536 - iron-sulfur cluster binding (Uniprot)
  • GO:0046872 - metal ion binding (Uniprot)
  • GO:0016740 - transferase activity (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0003824 - catalytic activity (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
• Links to additional information on pqqE:
  • KEGG - nucleotide and amino acid sequences of gene
  • BioCyc
  • Systems Biology
  • Mycobrowser
  • PATRIC
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -0.607 (from Jeremy Rock's lab)

Amino Acid Sequence

MTSPVPRLIEQFERGLDAPICLTWELTYACNLACVHCLSSSGKRDPGELSTRQCKDIIDELERMQVFYVNIGGGEPTVRPDFWELVDYATAHHVGVKFST
NGVRITPEVATRLAATDYVDVQISLDGATAEVNDAIRGTGSFDMAVRALQNLAAAGFAGVKISVVITRRNVAQLDEFATLASRYGATLRITRLRPSGRGT
DVWADLHPTADQQVQLYDWLVSKGERVLTGDSFFHLAPLGQSGALAGLNMCGAGRVVCLIDPVGDVYACPFAIHDHFLAGNVLSDGGFQNVWKNSSLFRE
LREPQSAGACGSCGHYDSCRGGCMAAKFFTGLPLDGPDPECVQGHSEPALARERHLPRPRADHSRGRRVSKPVPLTLSMRPPKRPCNESPV

Additional Information

MftC - mycofactocin radical-SAM maturase
Krishnamoorthy G, Kaiser P, Lozza L, Hahnke K, Mollenkopf HJ, Kaufmann SHE. Mycofactocin is associated with ethanol metabolism in mycobacteria. mBio 10, (2019).
https://mbio.asm.org/content/10/3/e00190-19/article-info

Analysis of Positive Selection in Clinical Isolates *new*

• Analysis of dN/dS (omega) in two collections of Mtb clinical isolates using GenomegaMap (Window model) (see description of methods)
  • Moldova: 2,057 clinical isolates
  • global set: 5,195 clinical isolates from 15 other countries
• In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
• A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.

	Moldova (2,057)	global set (5,195)
under significant positive selection?	NO	NO
omega peak height (95%CI lower bound)	2.11 (0.47)	1.42 (0.58)
codons under selection
omega plots
genetic variants*	link	link
statistics at each codon	link	link