TB Genome Annotation Portal

Rv0684 (fusA1)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: elongation factor G
  • REFSEQ: elongation factor G
  • PATRIC: Translation elongation factor G
  • TUBERCULIST: Probable elongation factor G FusA1 (EF-G)
  • NCBI: Probable elongation factor G FusA1 (EF-G)
  • updated information (H37Rv4):
    • gene name: fusA1
    • function:
    • reference:
• Type: Not Target
• Start: 782485
• End: 784590
• Operon:


• Trans-membrane region:
  
• Role: II.A.6 - Protein translation and modification
• GO terms:
  • GO:0040007 - growth (Uniprot)
  • GO:0006414 - translational elongation (Uniprot)
  • GO:0006412 - translation (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005737 - cytoplasm (Uniprot)
  • GO:0005622 - intracellular (Uniprot)
  • GO:0005618 - cell wall (Uniprot)
  • GO:0005525 - GTP binding (Uniprot)
  • GO:0003924 - GTPase activity (Uniprot)
  • GO:0003746 - translation elongation factor activity (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  1JQS	72%	Escherichia coli	Fitting of L11 protein and elongation factor G (domain G' and V) in the cryo-em map of E. coli 70S ribosome bound with EF-G and GMPPCP, a nonhydrolysable GTP analog
  5VH6	63%	Bacillus subtilis (strain 168)	2.6 Angstrom Resolution Crystal Structure of N-terminal Fragment (residues 1-406) of Elongation Factor G from Bacillus subtilis.
  5TV2	62%	Vibrio vulnificus	Crystal structure of a fragment (1-405) of an elongation factor G from Vibrio vulnificus CMCP6
  6BK7	61%	Enterococcus faecalis (strain ATCC 700802 / V583)	1.83 Angstrom Resolution Crystal Structure of N-terminal Fragment (residues 1-404) of Elongation Factor G from Enterococcus faecalis
  5OT7	61%	Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)	Elongation factor G-ribosome complex captures in the absence of inhibitors.
  4W29	61%	Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039)	70S ribosome translocation intermediate containing elongation factor EFG/GDP/fusidic acid, mRNA, and tRNAs trapped in the AP/AP pe/E chimeric hybrid state.
  4V9M	61%	Thermus thermophilus	70S Ribosome translocation intermediate FA-4.2A containing elongation factor EFG/FUSIDIC ACID/GDP, mRNA, and tRNA bound in the pe*/E state.
  4V9L	61%	Thermus thermophilus	70S Ribosome translocation intermediate FA-3.6A containing elongation factor EFG/FUSIDIC ACID/GDP, mRNA, and tRNA bound in the pe*/E state.
  4V9K	61%	Thermus thermophilus	70S ribosome translocation intermediate GDPNP-I containing elongation factor EFG/GDPNP, mRNA, and tRNA bound in the pe*/E state.
  4V9J	61%	Thermus thermophilus	70S ribosome translocation intermediate GDPNP-II containing elongation factor EFG/GDPNP, mRNA, and tRNA bound in the pe*/E state.

• Links to additional information on fusA1:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -12.492 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • BioCyc
  • Systems Biology
  • Mycobrowser
  • PATRIC
  • Photo of spot titer

Amino Acid Sequence

VAQKDVLTDLSRVRNFGIMAHIDAGKTTTTERILYYTGINYKIGEVHDGAATMDWMEQEQERGITITSAATTTFWKDNQLNIIDTPGHVDFTVEVERNLR
VLDGAVAVFDGKEGVEPQSEQVWRQADKYDVPRICFVNKMDKIGADFYFSVRTMGERLGANAVPIQLPVGAEADFEGVVDLVEMNAKVWRGETKLGETYD
TVEIPADLAEQAEEYRTKLLEVVAESDEHLLEKYLGGEELTVDEIKGAIRKLTIASEIYPVLCGSAFKNKGVQPMLDAVVDYLPSPLDVPPAIGHAPAKE
DEEVVRKATTDEPFAALAFKIATHPFFGKLTYIRVYSGTVESGSQVINATKGKKERLGKLFQMHSNKENPVDRASAGHIYAVIGLKDTTTGDTLSDPNQQ
IVLESMTFPDPVIEVAIEPKTKSDQEKLSLSIQKLAEEDPTFKVHLDSETGQTVIGGMGELHLDILVDRMRREFKVEANVGKPQVAYKETIKRLVQNVEY
THKKQTGGSGQFAKVIINLEPFTGEEGATYEFESKVTGGRIPREYIPSVDAGAQDAMQYGVLAGYPLVNLKVTLLDGAYHEVDSSEMAFKIAGSQVLKKA
AALAQPVILEPIMAVEVTTPEDYMGDVIGDLNSRRGQIQAMEERAGARVVRAHVPLSEMFGYVGDLRSKTQGRANYSMVFDSYSEVPANVSKEIIAKATG
E

Additional Information