TB Genome Annotation Portal

Rv0678 (-)

Amino Acid Sequence

VSVNDGVDQMGAEPDIMEFVEQMGGYFESRSLTRLAGRLLGWLLVCDPERQSSEELATALAASSGGISTNARMLIQFGFIERLAVAGDRRTYFRLRPNAF
AAGERERIRAMAELQDLADVGLRALGDAPPQRSRRLREMRDLLAYMENVVSDALGRYSQRTGEDD
(Nucleotide sequence available on KEGG)

Additional Information

transcriptional regulator; repressor of MmpL5/S5;

implicated in resistance to Bedaquiline and clofazimine
(Andries et al., 2014)
http://journals.plos.org/plosone/article?id=10.1371/journal.pone.0102135
(Hartkoorn et al., 2014)
http://aac.asm.org/content/early/2014/02/25/AAC.00037-14

PDB: 4nb5
(Radhakrisnan et al., 2014; https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4047419/)

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Non-Essential Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
0 non-insertions in a row out of 5 sites
Non-Essential Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 5 sites
Non-Essential Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
0 non-insertions in a row out of 5 sites
Non-Essential minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 5 sites
Non-Essential minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 5 sites
No-Data 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Too-Short C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: -1
Non-Essential 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).
TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.
Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

    • Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)



    TBCAP

    Tubculosis Community Annotation Project (    Slayden et al., 2013)

    Rv0678 (-)

    PropertyValueCreatorEvidencePMIDComment
    InteractionRegulatory Rv1221ashwinigbhatNASCo-expression (Functional linkage)
    R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
    CitationAzole resistance in Mycobacterium tuberculosis is mediated by the MmpS5-MmpL5 efflux system. A. Milano, MR. Pasca et al. Tuberculosis (Edinburgh, Scotland) 2008priti.prietyNAS18851927Co-expression (Functional linkage)
    InteractionRegulatory Rv1221priti.prietyNASCo-expression (Functional linkage)
    A. Milano, MR. Pasca et al. Azole resistance in Mycobacterium tuberculosis is mediated by the MmpS5-MmpL5 efflux system. Tuberculosis (Edinburgh, Scotland) 2008
    CitationThe Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. R. Manganelli, MI. Voskuil et al. Mol. Microbiol. 2001priti.prietyNAS11489128Co-expression (Functional linkage)
    InteractionRegulatory Rv1221priti.prietyNASCo-expression (Functional linkage)
    R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
    CitationAzole resistance in Mycobacterium tuberculosis is mediated by the MmpS5-MmpL5 efflux system. A. Milano, MR. Pasca et al. Tuberculosis (Edinburgh, Scotland) 2008ashwinigbhatNAS18851927Co-expression (Functional linkage)
    InteractionRegulatory Rv1221ashwinigbhatNASCo-expression (Functional linkage)
    A. Milano, MR. Pasca et al. Azole resistance in Mycobacterium tuberculosis is mediated by the MmpS5-MmpL5 efflux system. Tuberculosis (Edinburgh, Scotland) 2008
    CitationThe Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. R. Manganelli, MI. Voskuil et al. Mol. Microbiol. 2001ashwinigbhatNAS11489128Co-expression (Functional linkage)
    InteractionRegulatory Rv0676cashwinigbhatIEPCo-expression (Functional linkage)
    A. Milano, MR. Pasca et al. Azole resistance in Mycobacterium tuberculosis is mediated by the MmpS5-MmpL5 efflux system. Tuberculosis (Edinburgh, Scotland) 2008
    InteractionRegulatory Rv0677cpriti.prietyIEPCo-expression (Functional linkage)
    A. Milano, MR. Pasca et al. Azole resistance in Mycobacterium tuberculosis is mediated by the MmpS5-MmpL5 efflux system. Tuberculosis (Edinburgh, Scotland) 2008
    InteractionRegulatory Rv0677cashwinigbhatIEPCo-expression (Functional linkage)
    A. Milano, MR. Pasca et al. Azole resistance in Mycobacterium tuberculosis is mediated by the MmpS5-MmpL5 efflux system. Tuberculosis (Edinburgh, Scotland) 2008
    InteractionRegulatory Rv0676cpriti.prietyIEPCo-expression (Functional linkage)
    A. Milano, MR. Pasca et al. Azole resistance in Mycobacterium tuberculosis is mediated by the MmpS5-MmpL5 efflux system. Tuberculosis (Edinburgh, Scotland) 2008

    Comments