TB Genome Annotation Portal

Rv0655 (mkl)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: ABC transporter ATP-binding protein
  • REFSEQ: ribonucleotide ABC transporter ATP-binding protein
  • PATRIC: Methionine ABC transporter ATP-binding protein
  • TUBERCULIST: Possible ribonucleotide-transport ATP-binding protein ABC transporter Mkl
  • NCBI: Possible ribonucleotide-transport ATP-binding protein ABC transporter Mkl
  • updated information (H37Rv4):
    • gene name: mceG/mkl
    • function: interacts with mce1 and/or mce4
    • reference: Joshi (2006) PMID: 16868085
• Type: Not Target
• Start: 751517
• End: 752596
• Operon:


• Trans-membrane region:
  
• Role: II.C.5 - Other membrane proteins
• GO terms:
  • GO:0070508 - cholesterol import (Uniprot)
  • GO:0016887 - ATPase activity (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005618 - cell wall (Uniprot)
  • GO:0005524 - ATP binding (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • -> CHOLESTEROL[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  6IC4	39%	Acinetobacter baumannii	Cryo-EM structure of the A. baumannii MLA complex at 8.7 A resolution
  7CGE	38%	Escherichia coli (strain K12)	The overall structure of nucleotide free MlaFEDB complex
  6XGZ	38%	Escherichia coli LAU-EC10	Crystal structure of E. coli MlaFB ABC transport subunits in the monomeric state
  6XGY	38%	Escherichia coli LAU-EC10	Crystal structure of E. coli MlaFB ABC transport subunits in the dimeric state
  6XBD	38%	Escherichia coli DEC6A	Cryo-EM structure of MlaFEDB in nanodiscs with phospholipid substrates
  7CH0	38%	Escherichia coli (strain K12)	The overall structure of the MlaFEDB complex in ATP-bound EQclose conformation (Mutation of E170Q on MlaF)
  7CGN	38%	Escherichia coli (strain K12)	The overall structure of the MlaFEDB complex in ATP-bound EQtall conformation (Mutation of E170Q on MlaF)

• Links to additional information on mkl:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -0.126 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

VRYSDSYHTTGRWQPRASTEGFPMGVSIEVNGLTKSFGSSRIWEDVTLTIPAGEVSVLLGPSGTGKSVFLKSLIGLLRPERGSIIIDGTDIIECSAKELY
EIRTLFGVLFQDGALFGSMNLYDNTAFPLREHTKKKESEIRDIVMEKLALVGLGGDEKKFPGEISGGMRKRAGLARALVLDPQIILCDEPDSGLDPVRTA
YLSQLIMDINAQIDATILIVTHNINIARTVPDNMGMLFRKHLVMFGPREVLLTSDEPVVRQFLNGRRIGPIGMSEEKDEATMAEEQALLDAGHHAGGVEE
IEGVPPQISATPGMPERKAVARRQARVREMLHTLPKKAQAAILDDLEGTHKYAVHEIGQ

Additional Information

mceG
Nazarova et al (2017). Rv3723/LucA coordinates fatty acid and cholesterol uptake in Mycobacterium tuberculosis. eLife. https://pubmed.ncbi.nlm.nih.gov/28708968/