Rv0645c (mmaA1)
Current annotations:
TBCAP: (community-based annotations - see table at bottom of page )
TBDB: mycolic acid methyltransferase MmaA1
REFSEQ: methoxy mycolic acid synthase
PATRIC: Methoxy mycolic acid synthase 1 MmaA1 (EC 2.1.1.-)
TUBERCULIST: Methoxy mycolic acid synthase 1 MmaA1 (methyl mycolic acid synthase 1) (MMA1) (hydroxy mycolic acid synthase)
NCBI: Methoxy mycolic acid synthase 1 MmaA1 (methyl mycolic acid synthase 1) (MMA1) (hydroxy mycolic acid synthase)
updated information (H37Rv4):
gene name: mmaA1
function:
reference:
Coordinates in H37Rv: 739327 - 740187
Gene length: 861 bp (with stop codon), 286 aa (without stop codon)
Operon:
Trans-membrane region:
Role: I.H.2 - Modification of fatty and mycolic acids
GO terms:
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Latest Homologs in PDB
Top 10 Homologs in PDB (as of Apr 2026): PDB aa ident species PDB title 8RBL 100% Mycobacterium tuberculosis Crystal structure of Mycobacterium tuberculosis MmaA1 with S-adenosyl homocysteine 8RBE 100% Mycobacterium tuberculosis Crystal structure of Mycobacterium tuberculosis MmaA1 in apo form 8RBD 100% Mycobacterium tuberculosis Crystal structure of Mycobacterium tuberculosis MmaA1 with Sinefungin (SFG) 8RAQ 100% Mycobacterium tuberculosis H37Rv Crystal structure of Mycobacterium tuberculosis MmaA1 with S-adenosyl methionine (SAM) 8T1A 69% Mycobacterium tuberculosis H37Rv Crystal Structure of S-adenosylmethionine-dependent methyltransferase UmaA from Mycobacterium tuberculosis (P32 Twin) 7MCJ 69% Mycobacterium tuberculosis Crystal Structure of S-adenosylmethionine-dependent methyltransferase UmaA from Mycobacterium tuberculosis in complex with compound 8918 7LXI 69% Mycobacterium tuberculosis Crystal structure of S-adenosylmethionine-dependent methyltransferase UmaA from Mycobacterium tuberculosis in complex with SAH 7L9U 69% Mycobacterium tuberculosis Crystal Structure of S-adenosylmethionine-dependent methyltransferase UmaA from Mycobacterium tuberculosis in complex with a 12-mer PEG 1KPH 56% Mycobacterium tuberculosis Crystal Structure of mycolic acid cyclopropane synthase CmaA1 complexed with SAH and DDDMAB 1KPG 56% Mycobacterium tuberculosis Crystal Structure of mycolic acid cyclopropane synthase CmaA1 complexed with SAH and CTAB
Links to additional information on mmaA1:
Amino Acid Sequence
MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLAKVDLALDKLNLEPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHYE
RSKDRLAAIGTQRRAEARLQGWEEFEENVDRIVSFEAFDAFKKERYLTFFERSYDILPDDGRMLLHSLFTYDRRWLHEQGIALTMSDLRFLKFLRESIFP
GGELPSEPDIVDNAQAAGFTIEHVQLLQQHYARTLDAWAANLQAARERAIAVQSEEVYNNFMHYLTGCAERFRRGLINVAQFTMTK
(
Nucleotide sequence available on
KEGG )
Additional Information
MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb
TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions
Rv0645c/mmaA1,
gene len: 860 bp, num TA sites: 21
condition dataset call medium method notes
in-vitro DeJesus 2017 mBio growth advantage 7H9 HMM fully saturated, 14 TnSeq libraries combined
in-vitro Sassetti 2003 Mol Micro non-essential 7H9 TRASH essential if hybridization ratio<0.2
in-vivo (mice) Sassetti 2003 PNAS non-essential BL6 mice TRASH essential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol) Griffin 2011 PPath non-essential M9 minimal+glycerol Gumbel 2 replicates; Padj<0.05
in-vitro (cholesterol) Griffin 2011 PPath non-essential M9 minimal+cholesterol Gumbel 3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPath NO (LFC=-0.5) cholesterol vs glycerol resampling-SR YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitro Smith 2022 eLife growth advantage 7H9 HMM 6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice) Smith 2022 eLife growth advantage BL6 mice HMM 6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in mice Smith 2022 eLife NO (LFC=0.489) in-vivo vs in-vitro ZINB YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal) Minato 2019 mSys growth advantage minimal medium HMM
in-vitro (YM rich medium) Minato 2019 mSys growth advantage YM rich medium HMM 7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich medium Minato 2019 mSys NO (LFC=0.26) YM rich vs minimal medium resampling
Analysis of Positive Selection in Clinical Isolates
*new*
data from Culviner et al (2025) (55,259 Mtb clinical isolates)
overall pN/pS for Rv0645c: 0.367751776
lineage-specific pN/pS in L1: 0.351900406
lineage-specific pN/pS in L2: 0.31990946
lineage-specific pN/pS in L3: 0.31990946
lineage-specific pN/pS in L4: 0.420750486
Analysis of dN/dS (omega) in a global collection of 10k Mtb clinical isolates using GenomegaMap (Window model)
clinical isolates collection: global set of 10,626 Mtb genomes
In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.
global set of 10,626 Mtb clinical isolates
under significant positive selection? NO
omega peak height (95%CI lower bound) 0.73 (0.31)
codons under selection
omega plots
genetic variants* link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"
TnSeq Data No data currently available.
No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
No Proteomic data currently available for this Target.
Regulatory Relationships from Systems Biology
BioCyc
Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology )
NOTE:
see table of TFOE interactions below
Interactions based on ChIPSeq data
RNA processing and modification
Energy production and conversion
Chromatin structure and dynamics
Amino acid transport and metabolism
Cell cycle control, cell division, chromosome partitioning
Carbohydrate transport and metabolism
Nucleotide transport and metabolism
Lipid transport and metabolism
Coenzyme transport and metabolism
Translation, ribosomal structure and biogenesis
Cell wall/membrane/envelope biogenesis
Replication, recombination and repair
Posttranslational modification, protein turnover, chaperones
Secondary metabolites biosynthesis, transport and catabolism
Inorganic ion transport and metabolism
General function prediction only
Intracellular trafficking, secretion, and vesicular transport
Signal transduction mechanisms
Differentially expressed as result of RNASeq in glycerol environment (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
Conditionally essential as result of TNSeq (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
Binds To:
No bindings to other targets were found.
Bound By:
No bindings from other targets were found.
Binds To:
No bindings to other targets were found.
Bound By:
TFOE = Transcription Factor Over-Expression study
significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01
no significant interactions found
Upregulates:
Does not upregulate other genes.
Upregulated by:
Not upregulated by other genes.
Downregulates:
Does not downregulate other genes.
Downregulated by:
Not downregulated by other genes.
Property Value Creator Evidence PMID Comment
Term TBRXN:MYC1M2 Mycolic Acid Methyl Hydroxyl Addition - IDA njamshidi IDA 16356931 PMID: 16356931F. Boissier, F. Bardou et al. Further insight into S-adenosylmethionine-dependent methyltransferases: structural characterization of Hma, an enzyme essential for the biosynthesis of oxygenated mycolic acids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Citation Further insight into S-adenosylmethionine-dependent methyltransferases: structural characterization of Hma, an enzyme essential for the biosynthesis of oxygenated mycolic acids in Mycobacterium tuberculosis. F. Boissier, F. Bardou et al. J. Biol. Chem. 2006 njamshidi ISS 16356931 PMID: 16356931
Term TBRXN:MYC1M2 Mycolic Acid Methyl Hydroxyl Addition - ISS njamshidi ISS 16356931 PMID: 16356931F. Boissier, F. Bardou et al. Further insight into S-adenosylmethionine-dependent methyltransferases: structural characterization of Hma, an enzyme essential for the biosynthesis of oxygenated mycolic acids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Citation Further insight into S-adenosylmethionine-dependent methyltransferases: structural characterization of Hma, an enzyme essential for the biosynthesis of oxygenated mycolic acids in Mycobacterium tuberculosis. F. Boissier, F. Bardou et al. J. Biol. Chem. 2006 njamshidi IDA 16356931 PMID: 16356931
Citation Further insight into S-adenosylmethionine-dependent methyltransferases: structural characterization of Hma, an enzyme essential for the biosynthesis of oxygenated mycolic acids in Mycobacterium tuberculosis. F. Boissier, F. Bardou et al. J. Biol. Chem. 2006 njamshidi IDA 16356931 PMID: 16356931
Term TBRXN:MYC1M1 Mycolic Acid Methyl Hydroxyl Addition - IDA njamshidi IDA 16356931 PMID: 16356931F. Boissier, F. Bardou et al. Further insight into S-adenosylmethionine-dependent methyltransferases: structural characterization of Hma, an enzyme essential for the biosynthesis of oxygenated mycolic acids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Citation Further insight into S-adenosylmethionine-dependent methyltransferases: structural characterization of Hma, an enzyme essential for the biosynthesis of oxygenated mycolic acids in Mycobacterium tuberculosis. F. Boissier, F. Bardou et al. J. Biol. Chem. 2006 njamshidi ISS 16356931 PMID: 16356931
Term TBRXN:MYC1M1 Mycolic Acid Methyl Hydroxyl Addition - ISS njamshidi ISS 16356931 PMID: 16356931F. Boissier, F. Bardou et al. Further insight into S-adenosylmethionine-dependent methyltransferases: structural characterization of Hma, an enzyme essential for the biosynthesis of oxygenated mycolic acids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Name MmaA1 METHOXY MYCOLIC ACID SYNTHASE; trans cyclopropanation of methoxy- and ketomycolates mjackson IMP S-adenosyl-methionine-dependent mycolic acid methyltransferases
Citation Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. K. Takayama, C. Wang et al. Clin. Microbiol. Rev. 2005 jjmcfadden 15653820 Inferred from direct assay
Term EC:2.1.1.- Transferases. Transferring one-carbon groups. Methyltransferases. - NR jjmcfadden NR Inferred from direct assayK. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
Citation MMAS-1, the branch point between cis- and trans-cyclopropane-containing oxygenated mycolates in Mycobacterium tuberculosis. authors,Y. Yuan,DC. Crane,JM. Musser,S. Sreevatsan,CE. Barry J. Biol. Chem. 1997 extern:JZUCKER 9092547 Inferred from experiment
Term EC:2.1.1.- Transferases. Transferring one-carbon groups. Methyltransferases. - NR extern:JZUCKER NR Inferred from experimentauthors,Y. Yuan,DC. Crane,JM. Musser,S. Sreevatsan,CE. Barry MMAS-1, the branch point between cis- and trans-cyclopropane-containing oxygenated mycolates in Mycobacterium tuberculosis. J. Biol. Chem. 1997
Term EC:2.1.1.79 Cyclopropane-fatty-acyl-phospholipid synthase. - NR extern:JZUCKER NR Inferred from experimentauthors,Y. Yuan,DC. Crane,JM. Musser,S. Sreevatsan,CE. Barry MMAS-1, the branch point between cis- and trans-cyclopropane-containing oxygenated mycolates in Mycobacterium tuberculosis. J. Biol. Chem. 1997