TB Genome Annotation Portal

Rv0645c (mmaA1)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: mycolic acid methyltransferase MmaA1
  • REFSEQ: methoxy mycolic acid synthase
  • PATRIC: Methoxy mycolic acid synthase 1 MmaA1 (EC 2.1.1.-)
  • TUBERCULIST: Methoxy mycolic acid synthase 1 MmaA1 (methyl mycolic acid synthase 1) (MMA1) (hydroxy mycolic acid synthase)
  • NCBI: Methoxy mycolic acid synthase 1 MmaA1 (methyl mycolic acid synthase 1) (MMA1) (hydroxy mycolic acid synthase)
  • updated information (H37Rv4):
    • gene name: mmaA1
    • function:
    • reference:
• Type: Not Target
• Start: 739327
• End: 740187
• Operon:


• Trans-membrane region:
  
• Role: I.H.2 - Modification of fatty and mycolic acids
• GO terms:
  • GO:0071768 - mycolic acid biosynthetic process (Uniprot)
  • GO:0032259 - methylation (Uniprot)
  • GO:0016859 - cis-trans isomerase activity (Uniprot)
  • GO:0016740 - transferase activity (Uniprot)
  • GO:0008610 - lipid biosynthetic process (Uniprot)
  • GO:0008168 - methyltransferase activity (Uniprot)
  • GO:0006629 - lipid metabolic process (Uniprot)
  • GO:0005515 - protein binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • NADP[c] + SAM[c] + CIS_DELTA_37_ENOYL_METHY_HYDROXY_C56_ACYL_ACP[c] -> NADPH[c] + SAH[c] + CIS_DELTA_37_ENOYL_DIMETHY_HYDROXY_C... <Preview truncated at 128 characters>
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  1KPH	56%	Mycobacterium tuberculosis	Crystal Structure of mycolic acid cyclopropane synthase CmaA1 complexed with SAH and DDDMAB
  1KPG	56%	Mycobacterium tuberculosis	Crystal Structure of mycolic acid cyclopropane synthase CmaA1 complexed with SAH and CTAB
  1KP9	56%	Mycobacterium tuberculosis	Crystal structure of mycolic acid cyclopropane synthase CmaA1, apo-form
  1L1E	54%	Mycobacterium tuberculosis	Crystal Structure of Mycolic Acid Cyclopropane Synthase PcaA Complexed with S-adenosyl-L-homocysteine
  1TPY	53%	Mycobacterium tuberculosis	Structure of the cyclopropane synthase MmaA2 from Mycobacterium tuberculosis
  3HA7	51%	Mycobacterium tuberculosis	Crystal structure of HMA (MMAA4) from mycobacterium tuberculosis complexed with S-adenosyl-N-decyl-aminoethyl (SADAE)
  3HA5	51%	Mycobacterium tuberculosis	Crystal structure of HMA (MMAA4) from mycobacterium tuberculosis complexed with sinefungin
  3HA3	51%	Mycobacterium tuberculosis	Crystal structure of HMA (MMAA4) from mycobacterium tuberculosis complexed with S-adenosylhomocysteine
  2FK8	51%	Mycobacterium tuberculosis	Crystal structure of Hma (MmaA4) from Mycobacterium tuberculosis complexed with S-adenosylmethionine
  2FK7	51%	Mycobacterium tuberculosis	Crystal structure of Hma (MmaA4) from Mycobacterium tuberculosis, apo-form

• Links to additional information on mmaA1:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 1.562 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MAKLRPYYEESQSAYDISDDFFALFLDPTWVYTCAYFERDDMTLEEAQLAKVDLALDKLNLEPGMTLLDVGCGWGGALVRAVEKYDVNVIGLTLSRNHYE
RSKDRLAAIGTQRRAEARLQGWEEFEENVDRIVSFEAFDAFKKERYLTFFERSYDILPDDGRMLLHSLFTYDRRWLHEQGIALTMSDLRFLKFLRESIFP
GGELPSEPDIVDNAQAAGFTIEHVQLLQQHYARTLDAWAANLQAARERAIAVQSEEVYNNFMHYLTGCAERFRRGLINVAQFTMTK

Additional Information

Analysis of Positive Selection in Clinical Isolates *new*

• Analysis of dN/dS (omega) in two collections of Mtb clinical isolates using GenomegaMap (Window model) (see description of methods)
  • Moldova: 2,057 clinical isolates
  • global set: 5,195 clinical isolates from 15 other countries
• In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
• A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.

	Moldova (2,057)	global set (5,195)
under significant positive selection?	NO	NO
omega peak height (95%CI lower bound)	1.29 (0.23)	0.73 (0.25)
codons under selection
omega plots
genetic variants*	link	link
statistics at each codon	link	link