TB Genome Annotation Portal

Rv0642c (mmaA4)

Amino Acid Sequence

MTRMAEKPISPTKTRTRFEDIQAHYDVSDDFFALFQDPTRTYSCAYFEPPELTLEEAQYAKVDLNLDKLDLKPGMTLLDIGCGWGTTMRRAVERFDVNVI
GLTLSKNQHARCEQVLASIDTNRSRQVLLQGWEDFAEPVDRIVSIEAFEHFGHENYDDFFKRCFNIMPADGRMTVQSSVSYHPYEMAARGKKLSFETARF
IKFIVTEIFPGGRLPSTEMMVEHGEKAGFTVPEPLSLRPHYIKTLRIWGDTLQSNKDKAIEVTSEEVYNRYMKYLRGCEHYFTDEMLDCSLVTYLKPGAA
A
(Nucleotide sequence available on KEGG)

Additional Information



















    ESSENTIALITY 

    







    



MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb


TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv0642c/mmaA4,
gene len: 905 bp, num TA sites: 19



conditiondatasetcallmediummethodnotes

in-vitroDeJesus 2017 mBiogrowth advantage7H9HMMfully saturated, 14 TnSeq libraries combined

in-vitroSassetti 2003 Mol Micronon-essential 7H9TRASHessential if hybridization ratio<0.2

in-vivo (mice)Sassetti 2003 PNASno data BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)

in-vitro (glycerol)Griffin 2011 PPathnon-essentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05

in-vitro (cholesterol)Griffin 2011 PPathessentialM9 minimal+cholesterolGumbel3 replicates; Padj<0.05

differentially essential in cholesterol Griffin 2011 PPathNO (LFC=-2.9)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol

in-vitroSmith 2022 eLifegrowth defect7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)

in-vivo (mice)Smith 2022 eLifegrowth defectBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)

differentially essential in miceSmith 2022 eLifeNO (LFC=0.443)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice

in-vitro (minimal)Minato 2019 mSysgrowth defectminimal mediumHMM

in-vitro (YM rich medium)Minato 2019 mSysgrowth advantageYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)

differentially essential in YM rich mediumMinato 2019 mSysYES (LFC=6.87)YM rich vs minimal mediumresampling







    














Analysis of Positive Selection in Clinical Isolates
*new*







global set of 10,626 Mtb clinical isolates

under significant positive selection?NO

omega peak height (95%CI lower bound)1.53 (0.68)

codons under selection

omega plotsomega plot across ORF

genetic variants*link



* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"






 





    TnSeq Data    No data currently available.

    




    



        
  •  No TnSeq data currently available for this Target.



















    RNASeq Data   No data currently available.

    





    



        
  •  No RNA-Seq data currently available for this Target.




















    Metabolomic Profiles    No data currently available.

    





    




        
  •  No Metabolomic data currently available for this Target.




















    Proteomic Data   No data currently available. 

    






    



        
  •  No Proteomic data currently available for this Target.


















 





    Regulatory Relationships from Systems Biology 

    




    






                
  • BioCyc


    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)
    

    NOTE: 
see table of TFOE interactions below
    




    Interactions based on ChIPSeq data
    


    

    

    

    
    


                
    
                    
    
                    RNA processing and modification
                
    

                
    
                    
    
                    Energy production and conversion
                
    

                
    
                    
    
                    Chromatin structure and dynamics
                
    

                
    
                    
    
                    Amino acid transport and metabolism
                
    

                
    
                    
    
                    Cell cycle control, cell division, chromosome partitioning
                
    

                
    
                    
    
                    Carbohydrate transport and metabolism
                
    

                
    
                    
    
                    Nucleotide transport and metabolism
                
    

                
    
                    
    
                    Lipid transport and metabolism
                
    

                
    
                    
    
                    Coenzyme transport and metabolism
                
    

                
    
                    
    
                    Transcription
                
    

                
    
                    
    
                    Translation, ribosomal structure and biogenesis
                
    

                
    
                    
    
                    Cell wall/membrane/envelope biogenesis
                
    

                
    
                    
    
                    Replication, recombination and repair
                
    

                
    
                    
    
                    Posttranslational modification, protein turnover, chaperones
                
    

                
    
                    
    
                    Cell motility
                
    

                
    
                    
    
                    Secondary metabolites biosynthesis, transport and catabolism
                
    

                
    
                    
    
                    Inorganic ion transport and metabolism
                
    

                
    
                    
    
                    Function unknown
                
    

                
    
                    
    
                    General function prediction only
                
    

                
    
                    
    
                    Intracellular trafficking, secretion, and vesicular transport
                
    

                
    
                    
    
                    Signal transduction mechanisms
                
    

                
    
                    
    
                    Extracellular structures
                
    

                
    
                    
    
                    Defense mechanisms
                
    

                
    
                    
    
                    Nuclear structure
                
    

                
    
                    
    
                    Cytoskeleton
                
    


    
    
    
  • BioCyc

                    Co-regulated genes based on gene expression profiling (Systems Biology, Inferelator Network)
                
    • 

                
    
                    
                    Differentially expressed as result of RNASeq in glycerol environment (Only top 20 genes shown sorted by log fold change with p_adj 0.05). 
                
    

                
    
                    
                    Conditionally essential as result of TNSeq (Only top 20 genes shown sorted by log fold change with p_adj 0.05). 
                
    

                
    
                    
                
  • BioCyc

                    Transcription factor binding based on ChIP-Seq (Systems Biology)
                
    • 


    
    

    






    Interactions based on ChIPSeq data (Minch et al. 2014)
    




    Interactions based on TFOE data (Rustad et al. 2014)
    
TFOE = Transcription Factor Over-Expression study
    
significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01
    
no significant interactions found
    






    








    







    




    


    TBCAP
    
Tubculosis Community Annotation Project (    Slayden et al., 2013)
    
Rv0642c (mmaA4)

    

    PropertyValueCreatorEvidencePMIDComment
    
TermTBRXN:MYC1M2 Mycolic Acid Methyl Hydroxyl Addition - IDAnjamshidiIDA16356931PMID: 16356931
    F. Boissier, F. Bardou et al. Further insight into S-adenosylmethionine-dependent methyltransferases: structural characterization of Hma, an enzyme essential for the biosynthesis of oxygenated mycolic acids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
    
CitationFurther insight into S-adenosylmethionine-dependent methyltransferases: structural characterization of Hma, an enzyme essential for the biosynthesis of oxygenated mycolic acids in Mycobacterium tuberculosis. F. Boissier, F. Bardou et al. J. Biol. Chem. 2006njamshidiISS16356931PMID: 16356931
    
TermTBRXN:MYC1M2 Mycolic Acid Methyl Hydroxyl Addition - ISSnjamshidiISS16356931PMID: 16356931
    F. Boissier, F. Bardou et al. Further insight into S-adenosylmethionine-dependent methyltransferases: structural characterization of Hma, an enzyme essential for the biosynthesis of oxygenated mycolic acids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
    
CitationFurther insight into S-adenosylmethionine-dependent methyltransferases: structural characterization of Hma, an enzyme essential for the biosynthesis of oxygenated mycolic acids in Mycobacterium tuberculosis. F. Boissier, F. Bardou et al. J. Biol. Chem. 2006njamshidiIDA16356931PMID: 16356931
    
CitationFurther insight into S-adenosylmethionine-dependent methyltransferases: structural characterization of Hma, an enzyme essential for the biosynthesis of oxygenated mycolic acids in Mycobacterium tuberculosis. F. Boissier, F. Bardou et al. J. Biol. Chem. 2006njamshidiIDA16356931PMID: 16356931
    
TermTBRXN:MYC1M1 Mycolic Acid Methyl Hydroxyl Addition - IDAnjamshidiIDA16356931PMID: 16356931
    F. Boissier, F. Bardou et al. Further insight into S-adenosylmethionine-dependent methyltransferases: structural characterization of Hma, an enzyme essential for the biosynthesis of oxygenated mycolic acids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
    
CitationFurther insight into S-adenosylmethionine-dependent methyltransferases: structural characterization of Hma, an enzyme essential for the biosynthesis of oxygenated mycolic acids in Mycobacterium tuberculosis. F. Boissier, F. Bardou et al. J. Biol. Chem. 2006njamshidiISS16356931PMID: 16356931
    
TermTBRXN:MYC1M1 Mycolic Acid Methyl Hydroxyl Addition - ISSnjamshidiISS16356931PMID: 16356931
    F. Boissier, F. Bardou et al. Further insight into S-adenosylmethionine-dependent methyltransferases: structural characterization of Hma, an enzyme essential for the biosynthesis of oxygenated mycolic acids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
    
InteractionRegulatedBy Rv0348yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type  and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
    
NameMmaA4 METHOXY MYCOLIC ACID SYNTHASE 4; synthesis of oxygenated mycolatesmjacksonIMPS-adenosyl-methionine-dependent mycolic acid methyltransferases
    
TermEC:2.1.1.-  Transferases.  Transferring one-carbon groups.   Methyltransferases. - NRjjmcfaddenNRInferred from direct assay
    K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
    
CitationPathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. K. Takayama, C. Wang et al. Clin. Microbiol. Rev. 2005jjmcfadden15653820Inferred from direct assay
    
CitationTracking the putative biosynthetic precursors of oxygenated mycolates of Mycobacterium tuberculosis. Structural analysis of fatty acids of a mutant strain deviod of methoxy- and ketomycolates. authors,P. Dinadayala,F. Laval,C. Raynaud,A. Lemassu,MA. Laneelle,G. Laneelle,M. Daffe J. Biol. Chem. 2003extern:JZUCKER12473649Reaction blocked in mutant
    
TermEC:2.1.1.-  Transferases.  Transferring one-carbon groups.   Methyltransferases. - NRextern:JZUCKERNRReaction blocked in mutant
    authors,P. Dinadayala,F. Laval,C. Raynaud,A. Lemassu,MA. Laneelle,G. Laneelle,M. Daffe Tracking the putative biosynthetic precursors of oxygenated mycolates of Mycobacterium tuberculosis. Structural analysis of fatty acids of a mutant strain deviod of methoxy- and ketomycolates. J. Biol. Chem. 2003
    
TermEC:2.1.1.79 Cyclopropane-fatty-acyl-phospholipid synthase. - NRextern:JZUCKERNRReaction blocked in mutant
    authors,P. Dinadayala,F. Laval,C. Raynaud,A. Lemassu,MA. Laneelle,G. Laneelle,M. Daffe Tracking the putative biosynthetic precursors of oxygenated mycolates of Mycobacterium tuberculosis. Structural analysis of fatty acids of a mutant strain deviod of methoxy- and ketomycolates. J. Biol. Chem. 2003
    

    


    Comments