TB Genome Annotation Portal

Rv0634B (rpmG2)

• Current annotations:
  • TUBERCULIST: 50S ribosomal protein L33 RpmG2
  • NCBI: 50S ribosomal protein L33 RpmG2
  • updated information (H37Rv4):
    • gene name: rpmG2
    • function:
    • reference:
• Type: Not Target
• Start: 731712
• End: 731879
• Operon:


• Trans-membrane region:
  
• Role: -
• GO terms:
  • GO:0030529 - not-found (Uniprot)
  • GO:0006412 - translation (Uniprot)
  • GO:0005840 - ribosome (Uniprot)
  • GO:0005622 - intracellular (Uniprot)
  • GO:0003735 - structural constituent of ribosome (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  5V93	100%	Mycobacterium tuberculosis	Cryo-EM structure of the 70S ribosome from Mycobacterium tuberculosis bound with Capreomycin
  5V7Q	100%	Mycobacterium tuberculosis	Cryo-EM structure of the large ribosomal subunit from Mycobacterium tuberculosis bound with a potent linezolid analog
  5ZET	90%	Mycobacterium smegmatis str. MC2 155	M. smegmatis P/P state 50S ribosomal subunit
  5ZEP	90%	Mycobacterium smegmatis str. MC2 155	M. smegmatis hibernating state 70S ribosome structure
  5ZEB	90%	Mycobacterium smegmatis str. MC2 155	M. Smegmatis P/P state 70S ribosome structure
  5O61	90%	Mycobacterium smegmatis str. MC2 155	The complete structure of the Mycobacterium smegmatis 70S ribosome
  5O60	90%	Mycobacterium smegmatis str. MC2 155	Structure of the 50S large ribosomal subunit from Mycobacterium smegmatis
  6HTQ	60%	Bacillus subtilis (strain 168)	Stringent response control by a bifunctional RelA enzyme in the presence and absence of the ribosome
  5NJT	60%	Bacillus subtilis subsp. subtilis str. 168	Structure of the Bacillus subtilis hibernating 100S ribosome reveals the basis for 70S dimerization.
  6TPQ	59%	Bacillus subtilis subsp. subtilis str. 168	RNase M5 bound to 50S ribosome with precursor 5S rRNA

• Links to additional information on rpmG2:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -6.846 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MASSTDVRPKITLACEVCKHRNYITKKNRRNDPDRLELKKFCPNCGKHQAHRETR

Additional Information