TB Genome Annotation Portal

Rv0634B (rpmG2)

Amino Acid Sequence

MASSTDVRPKITLACEVCKHRNYITKKNRRNDPDRLELKKFCPNCGKHQAHRETR
(Nucleotide sequence available on KEGG)

Additional Information




Analysis of Positive Selection in Clinical Isolates *new*

Moldova (2,057)global set (5,195)
under significant positive selection?NONO
omega peak height (95%CI lower bound)0.57 (0.02)1.6 (0.57)
codons under selection
omega plots
genetic variantslinklink
statistics at each codonlinklink

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Too-Short Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: -1.000000;
3 non-insertions in a row out of 3 sites
Too-Short Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: -1.000000;
3 non-insertions in a row out of 3 sites
Too-Short Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: -1.000000;
3 non-insertions in a row out of 3 sites
Uncertain minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.981600;
4 non-insertions in a row out of 4 sites
Uncertain minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.980050;
4 non-insertions in a row out of 4 sites
No-Data 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Too-Short C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: -1
Growth-Defect 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

    Interactions based on TFOE data (Rustad et al. 2014)



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv0634B (rpmG2)

    PropertyValueCreatorEvidencePMIDComment
    CitationZinc-responsive regulation of alternative ribosomal protein genes in Streptomyces coelicolor involves zur and sigmaR. authors,GA. Owen,B. Pascoe,D. Kallifidas,MS. Paget J. Bacteriol. 2007prabhakarsmailISO17400736Footprinting
    InteractionRegulatory Rv2359prabhakarsmailISOFootprinting
    authors,GA. Owen,B. Pascoe,D. Kallifidas,MS. Paget Zinc-responsive regulation of alternative ribosomal protein genes in Streptomyces coelicolor involves zur and sigmaR. J. Bacteriol. 2007
    CitationGlobal analysis of the Mycobacterium tuberculosis Zur (FurB) regulon. A. Maciag, E. Dainese et al. J. Bacteriol. 2007prabhakarsmailISO17098899Footprinting
    InteractionRegulatory Rv2359prabhakarsmailISOFootprinting
    A. Maciag, E. Dainese et al. Global analysis of the Mycobacterium tuberculosis Zur (FurB) regulon. J. Bacteriol. 2007
    CitationThe zinc-responsive regulator Zur controls a zinc uptake system and some ribosomal proteins in Streptomyces coelicolor A3(2). authors,JH. Shin,SY. Oh,SJ. Kim,JH. Roe J. Bacteriol. 2007akankshajain.21ISO17416659Footprinting
    InteractionRegulatory Rv2359akankshajain.21ISOFootprinting
    authors,JH. Shin,SY. Oh,SJ. Kim,JH. Roe The zinc-responsive regulator Zur controls a zinc uptake system and some ribosomal proteins in Streptomyces coelicolor A3(2). J. Bacteriol. 2007
    CitationZinc-responsive regulation of alternative ribosomal protein genes in Streptomyces coelicolor involves zur and sigmaR. authors,GA. Owen,B. Pascoe,D. Kallifidas,MS. Paget J. Bacteriol. 2007akankshajain.21ISO17400736Footprinting
    InteractionRegulatory Rv2359akankshajain.21ISOFootprinting
    authors,GA. Owen,B. Pascoe,D. Kallifidas,MS. Paget Zinc-responsive regulation of alternative ribosomal protein genes in Streptomyces coelicolor involves zur and sigmaR. J. Bacteriol. 2007
    CitationGlobal analysis of the Mycobacterium tuberculosis Zur (FurB) regulon. A. Maciag, E. Dainese et al. J. Bacteriol. 2007akankshajain.21ISO17098899Footprinting
    InteractionRegulatory Rv2359akankshajain.21ISOFootprinting
    A. Maciag, E. Dainese et al. Global analysis of the Mycobacterium tuberculosis Zur (FurB) regulon. J. Bacteriol. 2007
    CitationThe zinc-responsive regulator Zur controls a zinc uptake system and some ribosomal proteins in Streptomyces coelicolor A3(2). authors,JH. Shin,SY. Oh,SJ. Kim,JH. Roe J. Bacteriol. 2007prabhakarsmailISO17416659Footprinting
    InteractionRegulatory Rv2359prabhakarsmailISOFootprinting
    authors,JH. Shin,SY. Oh,SJ. Kim,JH. Roe The zinc-responsive regulator Zur controls a zinc uptake system and some ribosomal proteins in Streptomyces coelicolor A3(2). J. Bacteriol. 2007

    Comments