TB Genome Annotation Portal

Rv0596c (vapB4)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: antitoxin
  • REFSEQ: hypothetical protein
  • PATRIC: FIG044579: hypothetical protein
  • TUBERCULIST: Possible antitoxin VapB4
  • NCBI: Possible antitoxin VapB4
  • updated information (H37Rv4):
    • gene name: vapB4
    • function:
    • reference:
• Type: Not Target
• Start: 695228
• End: 695485
• Operon:


• Trans-membrane region:
  
• Role: V - Conserved hypotheticals
• GO terms:
  • GO:0097351 - toxin-antitoxin pair type II binding (Uniprot)
  • GO:0045927 - positive regulation of growth (Uniprot)
  • GO:0005515 - protein binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  3DBO	44%	Mycobacterium tuberculosis	Crystal structure of a member of the VapBC family of toxin-antitoxin systems, VapBC-5, from Mycobacterium tuberculosis

• Links to additional information on vapB4:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -0.152 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MSATIPARDLRNHTAEVLRRVAAGEEIEVLKDNRPVARIVPLKRRRQWLPAAEVIGELVRLGPDTTNLGEELRETLTQTTDDVRW

Additional Information