TB Genome Annotation Portal

Rv0591 (mce2C)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: virulence factor Mce family protein
  • REFSEQ: MCE-family protein MCE2C
  • PATRIC: MCE-family protein Mce1C
  • TUBERCULIST: Mce-family protein Mce2C
  • NCBI: Mce-family protein Mce2C
  • updated information (H37Rv4):
    • gene name: mce2C
    • function:
    • reference:
• Type: Not Target
• Start: 689059
• End: 690504
• Operon:


• Trans-membrane region:
  
• Role: IV.A - Virulence
• GO terms:
  • No terms assigned.
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
• Links to additional information on mce2C:
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.261 (from Jeremy Rock's lab)

Amino Acid Sequence

MRTLTEFNRGRVGMMGAVVTVLVVGVAQSFTSVPMLFATPTYYAQFADTGGINTGDKVEIAGVNVGLVRSLAIRGNRVLIGFSLPGKTIGMQSRAAIRTD
TILGRKNLEIEPRGSEPLKPNGFLPLAQTTTPYQIYDAFVDVTKAATGWDIDAVKRSLNVLSETFDQTAPHLSAALEGVKAFSDTVGRRGEQIEQLLANA
NRIARVLGDRSEQVNGLLVNAKTLLAAFKQRSQALRILLTNVSEASAQVSGLITDNPNLNHVLAQLRTVSEELVKRKNELADVAVLLGRYTAALTEAVGS
GPFFKAMVVNLLPYQILQPWVDAAFKKRGIDPENFWRSAGLPEFRWPDPNGTRFPNGAPPAAPPVREGTPKHPGPAVPPGTPCSYTPAAGALPRPDTPLP
CAGATVGPFGGPDFPAPLDVQPSPPNPDGPPPTPGILSAGRPGEPAPAVPGIPMPLPPNAPPGARTQPLEPFPDGTGGSNQ

Additional Information