TB Genome Annotation Portal

Rv0590 (mce2B)

Amino Acid Sequence

MKTTGTTIKLGIVWLVLSVFTVMIIVVFGQVRFHHTTGYSAVFTHVSGLRAGQFVRAAGVEVGKVAKVTLIDGDKQVLVDFTVDRSLSLDQATTASIRYL
NLIGDRYLELGRGHSGQRLAPGATIPLEHTHPALDLDALLGGFRPLFQTLDPDKVNSIASSIITVFQGQGATINDILDQTASLTATLADRDHAIGEVVNN
LNTVLATTVKHQTEFDRTVDKLEVLITGLKNRADPLAAAAAHISSAAGTLADLLGRIVHCCTAASGTSRASSSRS
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Non-Essential Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
2 non-insertions in a row out of 10 sites
Non-Essential Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 10 sites
Non-Essential Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 10 sites
Non-Essential minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 11 sites
Non-Essential minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
4 non-insertions in a row out of 11 sites
No-Data 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Too-Short C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: -1
Non-Essential 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

    Interactions based on TFOE data (Rustad et al. 2014)

    • Upregulates:

      • Does not upregulate other genes.
    • Upregulated by:

      • Not upregulated by other genes.
    • Downregulates:

      • Does not downregulate other genes.
    • Downregulated by:



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv0590 (mce2B)

    PropertyValueCreatorEvidencePMIDComment
    InteractionOperon Rv0594kholia.truptiIEPCo-expression (Functional linkage)
    Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
    InteractionOperon Rv0594kholia.truptiIEPCo-expression (Functional linkage)
    authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
    InteractionOperon Rv0594kholia.truptiIEPCo-expression (Functional linkage)
    O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
    InteractionOperon Rv0593kholia.truptiIEPCo-expression (Functional linkage)
    Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
    InteractionOperon Rv0593kholia.truptiIEPCo-expression (Functional linkage)
    O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
    InteractionOperon Rv0593kholia.truptiIEPCo-expression (Functional linkage)
    authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
    InteractionOperon Rv0593kholia.truptiIEPCo-expression (Functional linkage)
    authors,M. Alonso-Hearn,TM. Eckstein,S. Sommer,LE. Bermudez A Mycobacterium avium subsp. paratuberculosis LuxR regulates cell envelope and virulence. Innate Immun 2010
    InteractionOperon Rv0592kholia.truptiIEPCo-expression (Functional linkage)
    Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
    InteractionOperon Rv0592kholia.truptiIEPCo-expression (Functional linkage)
    O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
    InteractionOperon Rv0592kholia.truptiIEPCo-expression (Functional linkage)
    authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
    InteractionOperon Rv0591kholia.truptiIEPCo-expression (Functional linkage)
    Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
    InteractionOperon Rv0591kholia.truptiIEPCo-expression (Functional linkage)
    O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
    InteractionOperon Rv0591kholia.truptiIEPCo-expression (Functional linkage)
    authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
    InteractionOperon Rv0590Akholia.truptiIEPCo-expression (Functional linkage)
    Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
    InteractionOperon Rv0590Akholia.truptiIEPCo-expression (Functional linkage)
    O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
    InteractionOperon Rv0590Akholia.truptiIEPCo-expression (Functional linkage)
    Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
    InteractionOperon Rv0591kholia.truptiIEPCo-expression (Functional linkage)
    Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
    InteractionOperon Rv0592kholia.truptiIEPCo-expression (Functional linkage)
    Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
    InteractionOperon Rv0593kholia.truptiIEPCo-expression (Functional linkage)
    Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
    InteractionOperon Rv0594kholia.truptiIEPCo-expression (Functional linkage)
    Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
    InteractionOperon Rv0590Akholia.truptiIEPCo-expression (Functional linkage)
    authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
    InteractionOperon Rv0589kholia.truptiIEPCo-expression (Functional linkage)
    O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
    InteractionOperon Rv0590Akholia.truptiIEPCo-expression (Functional linkage)
    O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
    InteractionOperon Rv0591kholia.truptiIEPCo-expression (Functional linkage)
    O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
    InteractionOperon Rv0592kholia.truptiIEPCo-expression (Functional linkage)
    O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
    InteractionOperon Rv0593kholia.truptiIEPCo-expression (Functional linkage)
    O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
    InteractionOperon Rv0594kholia.truptiIEPCo-expression (Functional linkage)
    O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
    CitationMycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). Y. Haile, DA. Caugant et al. FEMS Immunol. Med. Microbiol. 2002kholia.truptiIEP12052567Co-expression (Functional linkage)
    InteractionOperon Rv0589kholia.truptiIEPCo-expression (Functional linkage)
    Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
    CitationAnalysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. authors,A. Kumar,M. Bose,V. Brahmachari Infect. Immun. 2003kholia.truptiIEP14500535Co-expression (Functional linkage)
    InteractionOperon Rv0589kholia.truptiIEPCo-expression (Functional linkage)
    authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
    InteractionOperon Rv0590Akholia.truptiIEPCo-expression (Functional linkage)
    authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
    InteractionOperon Rv0591kholia.truptiIEPCo-expression (Functional linkage)
    authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
    InteractionOperon Rv0592kholia.truptiIEPCo-expression (Functional linkage)
    authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
    InteractionOperon Rv0593kholia.truptiIEPCo-expression (Functional linkage)
    authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
    InteractionOperon Rv0594kholia.truptiIEPCo-expression (Functional linkage)
    authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
    CitationMce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Tuberculosis (Edinb) 2010kholia.truptiIEP19963438Co-expression (Functional linkage)
    InteractionOperon Rv0589kholia.truptiIEPCo-expression (Functional linkage)
    Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
    InteractionOperon Rv0589kholia.truptiIEPCo-expression (Functional linkage)
    O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
    InteractionOperon Rv0589kholia.truptiIEPCo-expression (Functional linkage)
    authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
    InteractionOperon Rv0589kholia.truptiIEPCo-expression (Functional linkage)
    AK. Das, D. Mitra et al. Predicted molecular structure of the mammalian cell entry protein Mce1A of Mycobacterium tuberculosis. Biochem. Biophys. Res. Commun. 2003
    InteractionOperon Rv0589kholia.truptiIEPCo-expression (Functional linkage)
    D. Mitra, B. Saha et al. Correlating sequential homology of Mce1A, Mce2A, Mce3A and Mce4A with their possible functions in mammalian cell entry of Mycobacterium tuberculosis performing homology modeling. Tuberculosis (Edinburgh, Scotland) null
    InteractionRegulatory Rv0586sourish10IDAPhysical Interaction
    MD. Santangelo, F. Blanco et al. Mce2R from Mycobacterium tuberculosis represses the expression of the mce2 operon repressor from M. tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008
    InteractionRegulatory Rv0586sourish10IDAPhysical Interaction
    authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
    InteractionRegulatory Rv0586ahal4789IDAPhysical Interaction
    MD. Santangelo, F. Blanco et al. Mce2R from Mycobacterium tuberculosis represses the expression of the mce2 operon repressor from M. tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008
    InteractionRegulatory Rv0586ahal4789IDAPhysical Interaction
    authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
    InteractionRegulatedBy Rv0586yamir.morenoIEPLacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.).
    MD. Santangelo, F. Blanco et al. Mce2R from Mycobacterium tuberculosis represses the expression of the mce2 operon repressor from M. tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008

    Comments