TB Genome Annotation Portal

Rv0590 (mce2B)

Amino Acid Sequence

MKTTGTTIKLGIVWLVLSVFTVMIIVVFGQVRFHHTTGYSAVFTHVSGLRAGQFVRAAGVEVGKVAKVTLIDGDKQVLVDFTVDRSLSLDQATTASIRYL
NLIGDRYLELGRGHSGQRLAPGATIPLEHTHPALDLDALLGGFRPLFQTLDPDKVNSIASSIITVFQGQGATINDILDQTASLTATLADRDHAIGEVVNN
LNTVLATTVKHQTEFDRTVDKLEVLITGLKNRADPLAAAAAHISSAAGTLADLLGRIVHCCTAASGTSRASSSRS
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv0590/mce2B, gene len: 827 bp, num TA sites: 11
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBionon-essential7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Microno data 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASnon-essential BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathnon-essentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathnon-essentialM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=0.23)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifenon-essential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifenon-essentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=-0.31)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysnon-essentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysnon-essentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=-1.19)YM rich vs minimal mediumresampling

Analysis of Positive Selection in Clinical Isolates *new*

Moldova (2,057)global set (5,195)
under significant positive selection?NONO
omega peak height (95%CI lower bound)1.12 (0.18)1.8 (0.86)
codons under selection
omega plotsomega plot across ORF for Moldova isolatesomega plot across ORF for CRyPTIC isolates
genetic variants*linklink
statistics at each codonlinklink
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"



TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

    Interactions based on TFOE data (Rustad et al. 2014)

    • Upregulates:

      • Does not upregulate other genes.
    • Upregulated by:

      • Not upregulated by other genes.
    • Downregulates:

      • Does not downregulate other genes.
    • Downregulated by:



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv0590 (mce2B)

    PropertyValueCreatorEvidencePMIDComment
    InteractionOperon Rv0594kholia.truptiIEPCo-expression (Functional linkage)
    Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
    InteractionOperon Rv0594kholia.truptiIEPCo-expression (Functional linkage)
    authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
    InteractionOperon Rv0594kholia.truptiIEPCo-expression (Functional linkage)
    O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
    InteractionOperon Rv0593kholia.truptiIEPCo-expression (Functional linkage)
    Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
    InteractionOperon Rv0593kholia.truptiIEPCo-expression (Functional linkage)
    O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
    InteractionOperon Rv0593kholia.truptiIEPCo-expression (Functional linkage)
    authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
    InteractionOperon Rv0593kholia.truptiIEPCo-expression (Functional linkage)
    authors,M. Alonso-Hearn,TM. Eckstein,S. Sommer,LE. Bermudez A Mycobacterium avium subsp. paratuberculosis LuxR regulates cell envelope and virulence. Innate Immun 2010
    InteractionOperon Rv0592kholia.truptiIEPCo-expression (Functional linkage)
    Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
    InteractionOperon Rv0592kholia.truptiIEPCo-expression (Functional linkage)
    O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
    InteractionOperon Rv0592kholia.truptiIEPCo-expression (Functional linkage)
    authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
    InteractionOperon Rv0591kholia.truptiIEPCo-expression (Functional linkage)
    Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
    InteractionOperon Rv0591kholia.truptiIEPCo-expression (Functional linkage)
    O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
    InteractionOperon Rv0591kholia.truptiIEPCo-expression (Functional linkage)
    authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
    InteractionOperon Rv0590Akholia.truptiIEPCo-expression (Functional linkage)
    Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
    InteractionOperon Rv0590Akholia.truptiIEPCo-expression (Functional linkage)
    O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
    InteractionOperon Rv0590Akholia.truptiIEPCo-expression (Functional linkage)
    Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
    InteractionOperon Rv0591kholia.truptiIEPCo-expression (Functional linkage)
    Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
    InteractionOperon Rv0592kholia.truptiIEPCo-expression (Functional linkage)
    Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
    InteractionOperon Rv0593kholia.truptiIEPCo-expression (Functional linkage)
    Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
    InteractionOperon Rv0594kholia.truptiIEPCo-expression (Functional linkage)
    Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
    InteractionOperon Rv0590Akholia.truptiIEPCo-expression (Functional linkage)
    authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
    InteractionOperon Rv0589kholia.truptiIEPCo-expression (Functional linkage)
    O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
    InteractionOperon Rv0590Akholia.truptiIEPCo-expression (Functional linkage)
    O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
    InteractionOperon Rv0591kholia.truptiIEPCo-expression (Functional linkage)
    O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
    InteractionOperon Rv0592kholia.truptiIEPCo-expression (Functional linkage)
    O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
    InteractionOperon Rv0593kholia.truptiIEPCo-expression (Functional linkage)
    O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
    InteractionOperon Rv0594kholia.truptiIEPCo-expression (Functional linkage)
    O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
    CitationMycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). Y. Haile, DA. Caugant et al. FEMS Immunol. Med. Microbiol. 2002kholia.truptiIEP12052567Co-expression (Functional linkage)
    InteractionOperon Rv0589kholia.truptiIEPCo-expression (Functional linkage)
    Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
    CitationAnalysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. authors,A. Kumar,M. Bose,V. Brahmachari Infect. Immun. 2003kholia.truptiIEP14500535Co-expression (Functional linkage)
    InteractionOperon Rv0589kholia.truptiIEPCo-expression (Functional linkage)
    authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
    InteractionOperon Rv0590Akholia.truptiIEPCo-expression (Functional linkage)
    authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
    InteractionOperon Rv0591kholia.truptiIEPCo-expression (Functional linkage)
    authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
    InteractionOperon Rv0592kholia.truptiIEPCo-expression (Functional linkage)
    authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
    InteractionOperon Rv0593kholia.truptiIEPCo-expression (Functional linkage)
    authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
    InteractionOperon Rv0594kholia.truptiIEPCo-expression (Functional linkage)
    authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
    CitationMce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Tuberculosis (Edinb) 2010kholia.truptiIEP19963438Co-expression (Functional linkage)
    InteractionOperon Rv0589kholia.truptiIEPCo-expression (Functional linkage)
    Y. Haile, DA. Caugant et al. Mycobacterium tuberculosis mammalian cell entry operon (mce) homologs in Mycobacterium other than tuberculosis (MOTT). FEMS Immunol. Med. Microbiol. 2002
    InteractionOperon Rv0589kholia.truptiIEPCo-expression (Functional linkage)
    O. Marjanovic,T. Miyata,A. Goodridge,LV. Kendall,LW. Riley Mce2 operon mutant strain of Mycobacterium tuberculosis is attenuated in C57BL/6 mice. Tuberculosis (Edinb) 2010
    InteractionOperon Rv0589kholia.truptiIEPCo-expression (Functional linkage)
    authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
    InteractionOperon Rv0589kholia.truptiIEPCo-expression (Functional linkage)
    AK. Das, D. Mitra et al. Predicted molecular structure of the mammalian cell entry protein Mce1A of Mycobacterium tuberculosis. Biochem. Biophys. Res. Commun. 2003
    InteractionOperon Rv0589kholia.truptiIEPCo-expression (Functional linkage)
    D. Mitra, B. Saha et al. Correlating sequential homology of Mce1A, Mce2A, Mce3A and Mce4A with their possible functions in mammalian cell entry of Mycobacterium tuberculosis performing homology modeling. Tuberculosis (Edinburgh, Scotland) null
    InteractionRegulatory Rv0586sourish10IDAPhysical Interaction
    MD. Santangelo, F. Blanco et al. Mce2R from Mycobacterium tuberculosis represses the expression of the mce2 operon repressor from M. tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008
    InteractionRegulatory Rv0586sourish10IDAPhysical Interaction
    authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
    InteractionRegulatory Rv0586ahal4789IDAPhysical Interaction
    MD. Santangelo, F. Blanco et al. Mce2R from Mycobacterium tuberculosis represses the expression of the mce2 operon repressor from M. tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008
    InteractionRegulatory Rv0586ahal4789IDAPhysical Interaction
    authors,A. Kumar,M. Bose,V. Brahmachari Analysis of expression profile of mammalian cell entry (mce) operons of Mycobacterium tuberculosis. Infect. Immun. 2003
    InteractionRegulatedBy Rv0586yamir.morenoIEPLacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.).
    MD. Santangelo, F. Blanco et al. Mce2R from Mycobacterium tuberculosis represses the expression of the mce2 operon repressor from M. tuberculosis. Tuberculosis (Edinburgh, Scotland) 2008

    Comments