TB Genome Annotation Portal

Rv0586 (mce2R)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: transcriptional regulator gntR-family
  • REFSEQ: GntR family transcriptional regulator
  • PATRIC: Transcriptional regulator GntR family
  • TUBERCULIST: Probable transcriptional regulatory protein Mce2R (GntR-family)
  • NCBI: Probable transcriptional regulatory protein Mce2R (GntR-family)
  • updated information (H37Rv4):
    • gene name: mce2R/fadR
    • function: regulator of fatty acid metabolism
    • reference: Yousuf (2018) PMID: 29993358
• Type: Not Target
• Start: 684410
• End: 685132
• Operon:


• Trans-membrane region:
  
• Role: I.J.1 - Repressors/activators
• GO terms:
  • GO:0052572 - response to host immune response (Uniprot)
  • GO:0045892 - negative regulation of transcription, DNA-templated (Uniprot)
  • GO:0043565 - sequence-specific DNA binding (Uniprot)
  • GO:0032993 - protein-DNA complex (Uniprot)
  • GO:0006355 - regulation of transcription, DNA-templated (Uniprot)
  • GO:0006351 - transcription, DNA-templated (Uniprot)
  • GO:0003700 - DNA binding transcription factor activity (Uniprot)
  • GO:0003677 - DNA binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  4WWC	42%	Bacillus subtilis	Crystal structure of full length YvoA in complex with palindromic operator DNA
  4U0Y	42%	Bacillus subtilis subsp. subtilis str. 168	Crystal structure of the DNA-binding domains of YvoA in complex with palindromic operator DNA
  4U0W	42%	Bacillus subtilis subsp. subtilis str. 168	Crystal structure of YvoA from Bacillus subtilis in complex with N-acetylglucosamine-6-phosphate
  4U0V	42%	Bacillus subtilis subsp. subtilis str. 168	Crystal structure of YvoA from Bacillus subtilis in complex with glucosamine-6-phosphate
  2WV0	42%	BACILLUS SUBTILIS	Crystal structure of the GntR-HutC family member YvoA from Bacillus subtilis
  5KVR	41%	Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)	X-Ray Crystal Structure of a Fragment (1-75) of a Transcriptional Regulator PdhR from Escherichia coli CFT073
  4PDK	37%	Vibrio cholerae serotype O1 (ATCC 39315 / El Tor Inaba N16961)	FadR, Fatty Acid Responsive Transcription Factor from Vibrio cholerae, in Complex with oleoyl-CoA
  4P9U	37%	Vibrio cholerae	FadR, Fatty Acid Responsive Transcription Factor from Vibrio cholerae, in Complex with DNA
  4P96	37%	Vibrio cholerae HC-21A1	FadR, Fatty Acid Responsive Transcription Factor from Vibrio cholerae
  5XGF	35%	Vibrio alginolyticus E0666	The fatty acid-responsive FadR repressor of Vibrio alginolyticus

• Links to additional information on mce2R:
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 1.004 (from Jeremy Rock's lab)

Amino Acid Sequence

MALQPVTRRSVPEEVFEQIATDVLTGEMPPGEALPSERRLAELLGVSRPAVREALKRLSAAGLVEVRQGDVTTVRDFRRHAGLDLLPRLLFRNGELDISV
VRSILEARLRNFPKVAELAAERNEPELAELLQDSLRALDTEEDPIVWQRHTLDFWDHVVDSAGSIVDRLMYNAFRAAYEPTLAALTTTMTAAAKRPSDYR
KLADAICSGDPTGAKKAAQDLLELANTSLMAVLVSQASRQ

Additional Information